GENSCAN 1.0	Date run: 16-Jan-104	Time: 17:28:18

Sequence DUSP22_1 : 61656 bp : 47.56% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  10047  10198  152  2  2   77   70   130 0.782   9.62
ttttccaggttgaaagcccacatcagggtccttggctgtaagcaacagcatccaaatgtg
gttaccttaggtagaacagggcagacagcctggaaggctggagagccagactcaggggca
accttggcaggagcagatgctgtaagtggtcagtgagagcatttctggggctaccgcaag
ATGCTGATGCTACAGCCAGTGGACACTGAATGTGCCACCAGCCCTGCTGCCTCTGTTGCC
AAAGAGGACACTCTAGGCTATCCCTGCAGCCGGCGTGCAGACTTGTTACACGTGGGTCAC
ACCCATGTAGCAGCAAAGGCTTACGTGAGCAG
gtatctggcattggcagcttctatactaacagctgggctctgcttcccaccaagactccc
tggggccagggtatccccaaacctaggaaagggtttcagagactggaaaaccaataagat
aaatggccattacagggtttgtggttttcgagcatacccaagggataaaggaccccaaac

 1.02 Intr +  11160  11253   94  0  1  -23   83   119 0.376   0.27
attagaatgtagagacggtctactcttatgccctcatttaattttaaagataatataaaa
tgtattaatttgtgcttagtagagaagatagtagatgtacaaagaaaaaaagcaaaaatg
ggccataatctgttttccgaataatccctcttgatttaaaaaaagtgcaaattggcatag
TGCATGCACAGGACTGGAGTGTCAGATGGCGGAGGCAAGCTCAGAGAGAAATGCAGAAGC
CCTCCTCCAGGACCCCGCCATCGCCGTCACGGAG
gtgagcatggtgacgaagggagtgtacgtgcacacagctgtacctttcctgtttttcata
ccattttcaagatatattaagttaaaacgcgtaagatcgtcttcctcacagccccacaca
tcttaggcgtcgtattccatttcatggcacctaacttggagtctggatagtggccagtgg

 1.03 Intr +  13732  13765   34  0  1  119  113    70 0.511  10.40
aacccacggccttccacaggccgctggggatgttgggtcacccgcgtgtctgtcagggag
gtgctgtactggggaagcacctggcctttgcagggatcctgctgctggatgaggccccct
tctgcaataccatccacttagagtctgccatgctcatgtctgtgtctgtctctctcctag
ATCCTGCCCGGCCTGTACATCGGCAACTTCAAAG
gtgagttcttgcttttttattgttgtgataaaatacacataacataaaatgtgtcatctt
gaccattttaaagtgtataggtcagtggctttaagtaatttgcattgctgtgcagccatc
accaacatccttctgcaggacttttcatgttcccaaactgaaactgtgtcccttaaaaca

 1.04 Intr +  20984  21066   83  0  2   92   94    17 0.174   2.06
aagttaggcaaaatatatgaaagcagtagccctaagtttcctacatgtatggtcagttat
gaagtttcaggaaagaaatatgcaagtcattttgtgggtttttttttttttctggctaga
ctttaggagtaattaacttgcaaagatatcaaaatgtccatcccctttcttctctgacag
ATGCCAGAGACGCGGAACAATTGAGCAAGAACAAGGTGACACATATTCTGTCTGTCCACG
ATAGTGCCAGGCCTATGTTGGAG
gtaagagagcaccgtggggcgtgtgtgggtgtcctcatttgtattccgtgggagtaccta
cgacgttaatgaaggcaaccaggttctctccaatgcgaacgtactcctgtgatctctggc
ggcattcccattgtgttcaggccgtgttgatgttaacacgctgtctgtagcgtggcgcga

 1.05 Intr +  28894  29107  214  0  1   95   65    46 0.246   1.29
ccatttgcgttggccattgtttccagcgtgggtgaattcagctatcttaccgaaaaacac
tgtgggtgtcaagttgctagaaaggtccaagtcttttgaaaaccagttgctgtttgacct
ggaatggttttcagattgacagttgtttccagcacacctcagttgttttcatctctctag
GAAAACCTCTTTGAAGCCACCCAGAATCAGTGGTACTTTGCTGTACCAAAAGCTTACAGC
AGCTTTCGTGTGTTGAGGCAAATTTGTTTGAAGCCAACCCCAGATTTAAATAGATATGAC
TCAAATAGAAATGATTATAGCAGGGATCGAAAACTGTCTAGTAATCGCTCTTTCTTGAAG
CAAGCTGTATCTAGGTTTCTCGTGTGGCAGTCGG
gtgtgtaagagcggcccctccactggctggtcctgctaccacagactcacttgcaaatgg
agccctagaactcctgcatggctggactcagagggcttgagatcttccagtacttaactg
agtctagggaggacatggttttttaaacttctaaatcaaagaactcttttggcctggctt

 1.06 Intr +  31637  31996  360  0  0   55   63   132 0.156   2.59
gtgtgggttctagttagtctcagctcttctgagtgcagtccttggggttccctgcagggg
cgcctcagggtactctggccccagtgtagagcttgagttttgcttcccccaagctgagat
tttgcagcttctcattcacagattccaacccaagaagaccctcgtgtttggctgttttag
GTGCTGTGGACACTGGAAAGGGGAGACTAGGTGACGTGAATAGCAAGTCTGAAATGCTTT
CAGAGGAGATGCAATTCTGTAAGGCGTTTGAAAGAGAAGACAGGCTTAGGTTGGTAGAAA
CAACCAAGGAGAATATCCGTGGAGAGCATCCACGGAGGGAAAGAGTGTTTCTTGTTCCGG
GTCGGGACAGCACCGTGTGTGGCTGGCTGACTAGCAGAAAGCTTAAGCATCATGGTGGTG
GTGGTGATGGAAGAGGACATCTAGTCCAGGGAGATTCCGTGGGTTATGGCTGCTTGGTGG
GGCGGGGGGGGGCCTTCGAGTCTGCAATAGGAAGTTTGAATGGGAAGTTAAAGGGGGTAG

gttggttaagacccaaagccgggttaaagggctctctgggcaccattgttgtttttagcc
ataagaaaatgcgccctagtttaccaaagactggtttaagcaaatctgctgttttcaggt
gctctgaataatcattgcctgctaggcaatgcaggtggaccttgtgtttgcccacacctg

 1.07 Intr +  34210  34451  242  2  2   78   70   238 0.424  18.27
gcgcttcgtgcctccctaaggagggagctgtgtttaaggcaggctgccgcatcctgccgg
gaaggggaggctggctcagggagataggtacagcacacagcttgaagagcagtgtggccc
tctccctgctggtgcctggagagtcatctgccctgggcttccgcatcctcgtgtgtgcag
TGCTGTACCTGCTGGTGCCTAGAGAGTCATCTGCCCTGGGCTTCTGCGTCCTGGTGTGTG
CAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGCGTCCTGGTGT
GTGCAGTGCTATATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGCGTCCTGG
TGTGTGCAATGCTGTATCTGCGGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCATCC
TG
gtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttctgcgtcct
ggtgtgtgcagtgctgtacctgctggtgcctggagagtcatctgccctgggcttccgtat
cctggtgtgtgcagtgctgtatctgctggtgcctggagagtcatctgccctgggcttccg

 1.08 Intr +  34462  34701  240  0  0   59   70   260 0.547  19.05
tgctggtgcctggagagtcatctgccctgggcttccgcgtcctggtgtgtgcagtgctat
atctgctggtgcctggagagtcatctgccctgggcttccgcgtcctggtgtgtgcaatgc
tgtatctgcgggtgcctggagagtcatctgccctgggcttctgcatcctggtgtgtgcag
TGCTGTATCTGCTGGTGCCTGGAGTCATCTGCCCTGGGCTTCTGCGTCCTGGTGTGTGCA
GTGCTGTACCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGTATCCTGGTGTGT
GCAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGCGTCCTGGTG
TGTGCAATGCTGTATCTGCGGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCATCCTG

gtgtgtgcaatgctgtatctgctggtgcctggagtcatctgccctgggcttctgcatcct
cgtgtgtgcagtgctgtacctgctggtgcctggagtcatctgccctgggcttccgcatcc
tcgtgtgtgcagtgctgtacctgctggtgcctggagagtcatctgccctgggcttctgcg

 1.09 Intr +  34773  35010  238  2  1   76   70   246 0.990  18.79
tctgctggtgcctggagagtcatctgccctgggcttccgcgtcctggtgtgtgcaatgct
gtatctgcgggtgcctggagagtcatctgccctgggcttctgcatcctggtgtgtgcaat
gctgtatctgctggtgcctggagtcatctgccctgggcttctgcatcctcgtgtgtgcag
TGCTGTACCTGCTGGTGCCTGGAGTCATCTGCCCTGGGCTTCCGCATCCTCGTGTGTGCA
GTGCTGTACCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCGTTCTGGTGTGT
GCAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGCGTCCTGGTG
TGTGCAATGCTGTATCTGCTGGTGTCTGGAGTCATCTTCCCTGGGCTTCTGCGTCCTG
gtgtgtgcagtgctgtatctgctggtgcctggagagtcatctgcgctgggcttctgcgtc
ctggtgtgtgcaatgctgtatctgctggtgcctggagagtcatctgccctgggcttctgc
gttctggtgtgtgcagtgctgtatctgctggtgcctggagagtcatctgccctgggcttc

 1.10 Intr +  35021  35386  366  0  0   59   70   305 0.758  20.92
cctgctggtgcctggagagtcatctgccctgggcttctgcgttctggtgtgtgcagtgct
gtatctgctggtgcctggagagtcatctgccctgggcttccgcgtcctggtgtgtgcaat
gctgtatctgctggtgtctggagtcatcttccctgggcttctgcgtcctggtgtgtgcag
TGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCGCTGGGCTTCTGCGTCCTGGTGTGTG
CAATGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCGTTCTGGTGT
GTGCAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCCCGTCCTGG
TGTGTGCAATGCTGTATCTGCTGGTGCCTGGAGAGTCGTCTTCCCTCGGCTTCTGTGTCC
TGGTGTGTGCAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCG
TCCTGGTGTGTGCAATGCTGTATCTGCTGGTGCCTGGAGTCATCTTCCCTGGGCTTCTGC
GTCCTG
gtgtgtgcagtgctgtatctgctggtgtctggagagtcatctgccctgggcttctgcgtt
ctggtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttccgcgt
cctggtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttctgcg

 1.11 Intr +  35397  35449   53  1  2   59   70    55 0.758  -0.57
tctgctggtgcctggagagtcgtcttccctcggcttctgtgtcctggtgtgtgcagtgct
gtatctgctggtgcctggagagtcatctgccctgggcttctgcgtcctggtgtgtgcaat
gctgtatctgctggtgcctggagtcatcttccctgggcttctgcgtcctggtgtgtgcag
TGCTGTATCTGCTGGTGTCTGGAGAGTCATCTGCCCTGGGCTTCTGCGTTCTG
gtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttccgcgtcct
ggtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttctgcgtcc
tggtgtctgcaatgctgtatctgcgggtgcctggagagtcatctgccctgggcttccgcg

 1.12 Intr +  35460  35510   51  2  0   65   70    53 0.538   0.30
tctgctggtgcctggagagtcatctgccctgggcttctgcgtcctggtgtgtgcaatgct
gtatctgctggtgcctggagtcatcttccctgggcttctgcgtcctggtgtgtgcagtgc
tgtatctgctggtgtctggagagtcatctgccctgggcttctgcgttctggtgtgtgcag
TGCTGTATCTGCTGGTGCCTGGAGTCATCTGCCCTGGGCTTCCGCGTCCTG
gtgtgtgcagtgctgtatctgctggtgcctggagtcatctgccctgggcttctgcgtcct
ggtgtctgcaatgctgtatctgcgggtgcctggagagtcatctgccctgggcttccgcgt
cctggtgtgtgcagtgctgtatctgctggtgcctggagagtcatctgccctgggcttctg

 1.13 Intr +  35521  35697  177  0  0   66   70   203 0.810  16.42
tatctgctggtgcctggagtcatcttccctgggcttctgcgtcctggtgtgtgcagtgct
gtatctgctggtgtctggagagtcatctgccctgggcttctgcgttctggtgtgtgcagt
gctgtatctgctggtgcctggagtcatctgccctgggcttccgcgtcctggtgtgtgcag
TGCTGTATCTGCTGGTGCCTGGAGTCATCTGCCCTGGGCTTCTGCGTCCTGGTGTCTGCA
ATGCTGTATCTGCGGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCCGCGTCCTGGTGTGT
GCAGTGCTGTATCTGCTGGTGCCTGGAGAGTCATCTGCCCTGGGCTTCTGCGTCCTG
gtgtgtgcagtgctgtatctgctggtaattatgcagatgggattgcccttgagggagagt
cactggcaaatcctgtctactaccatttattgagcatctactgtgttctggcactgcact
tagtatttttcacatgtcacattgactttccttgtttaaagtcctgtgttcaagggaaat

 1.14 Intr +  44218  44267   50  0  2   94   95     7 0.094  -0.52
cggaaaataaccaggaactttaattagtttttctgcagttccttggcaacaaaagatgag
tgaaaaacttctcctttttatttttttattttttgacctgtgtaaatagttccttaaata
cttttctccactgagtttcatgtttttatttttatgtatttactttttattattctgcag
GGAGTTAAATACCTGTGCATCCCAGCAGCGGATTCACCATCTCAAAACCT
gtaagtttcttatttctgtattatttggagacatttaaaaaaatgaatagaggatggtaa
agtcagagaagtagaagactgtgaagttgtcagagctcacgggacccttgctgaccctgc
cagggaagaggctgtgagcctacagaggccaacgctaggcaggctgggatgagctgtggc

 1.15 Intr +  51346  51481  136  1  1   69   49    72 0.281   1.97
gggattcagttgtcatctttacaagaccttggtgaggttcgtacaactgaatgtgacccc
aatcctgtccccactcagatgggcagctgctaactttcatgttgctgtgtggtctttgca
gtgtgttctgacgtgctctgtggtttttcatttactcaggcggtcgtcattcatttctag
ATTTGCTTTTGCTTTTTTGGCTGCTCTGCGTACAGACACGGCTCTTTCTGACCAGAAAGA
GACCCACACAGAACAGACCAGCGTGGGCACAGCAGTCAGGGACAGCGTCTTGGCACCCTT
GGGGGGCCACAGCAGC
gtgagcagcctgggggaccaaggagggtgccgtccagctgcacccctgcagccagccagt
cagctgccccagcctgtgcactggcctgtctactgcagcctgcaaggagggcaggcaccc
agtgtaaaccaccaggcaagttgcagaccagcagtctggagccacttctgggccagatga

 1.16 Intr +  51580  51707  128  0  2   87   69    25 0.424  -0.02
gaaagagacccacacagaacagaccagcgtgggcacagcagtcagggacagcgtcttggc
acccttggggggccacagcagcgtgagcagcctgggggaccaaggagggtgccgtccagc
tgcacccctgcagccagccagtcagctgccccagcctgtgcactggcctgtctactgcag
CCTGCAAGGAGGGCAGGCACCCAGTGTAAACCACCAGGCAAGTTGCAGACCAGCAGTCTG
GAGCCACTTCTGGGCCAGATGAGTTGGCTCAAGGTTTCAAACATTTTTGAACTAGTTGCT
GATATCAG
gtagcatgaatttggccatgagtggcagaataccgtgtttgactgacacatggcattcta
agggagagagacacttggcagcaggtggtgcagctctgagcatggcactcgctcccagct
ccatggccggaggtcaggggcagagatagatcactttcctctcttcgggaagggaaaggt

 1.17 Intr +  52015  52060   46  1  1   79   70    44 0.246   0.11
cggaggtcaggggcagagatagatcactttcctctcttcgggaagggaaaggttttccag
aagtccctacccacagcctttccattgcttcaacatggacagagctgcaggaagacagga
tgtccttcccaaacaaaatcagtgcggctgacatgtcttgtccggttccattatctccag
GCCAGCAGACTTCTCTGCCAACCGCAGACGGCTAGTTGTGCTGAAG
gtgtggggagctcccagctggctacccagctctttgctgggggccaggctcctgcccaac
aaggctcccttcgtgccccactctgctgtatacttggctttgcggcctggctgtaatggg
tgtctgctctggagtgtccttcggcactgataccttagatttcgggattacagcaggaat

 1.18 Intr +  52719  52909  191  2  2   40   92    60 0.458  -0.02
gtctgctcacgctgctgtggccccccaagggtgccaagacgctgtccctgcctgcagtgc
ccactctggtctgttcttatttacatctgggggcagttatccctgggaaagttaacaaaa
gcagatgtgctagttagagatgtcaggtcagagtccggagtccttgatttggtcccctag
GGATTTGTGCTTGTGGTGACCCTTGCAGTTGTTGCAGAACATGTGTGTGCATGTTTGCGT
GTGCATGTTTGCGTGTGCATGTTTGCATGTGGATGCATGCACATGGACAGTTGCTGCTGT
TCCCTGGCTGTCCTCATCTCACTGAGCACCTGCCGTGAGGTCGCTGAGTTTCTTCTGCAG
TCAGTACCTGG
gtgagtttgttaggccgtgcctgaatttctcattcttattacattcatgtgccctggcat
tctgaatgtcttacagtttatcagagtccctggcaaattgtcagtactcagtcagtgttt
aaagagaagtcagtttagtccatgggcaacttttgctgttttataagccattcaaaggta

 1.19 Intr +  54958  55032   75  1  0   93   92    10 0.495   0.53
ttatacaatgtatacatgcattgaagtgtcacactgtagcccataaatatgtagaattat
gtgtcaattatacaaaaaaatcaattaacattttaagaaagaagcctcaggtagaatttt
cttttcatcatatattgagtaaagtagagagatgtcatttctctttttttcttttcccag
GACAAGACATTTCAAAGAAAGTATTAAATTCATTCACGAGTGCCGGCTCCGCGGTGAGAG
CTGCCTTGTACACTG
gtacgtgtgtctcttgcttaatagcgccttagcgtattctggtcggcttggcttcccatc
aagtgtttttccgtgtgtgaataatggtttcacctcctaatagttttctgtaaaccctga
ctctcaaacgcgtgctccatttgtccagcgctgtgtgttagtcgccctttccttctgttg

 1.20 Intr +  57207  57378  172  0  1  101  115   207 0.992  24.65
agggagctggtacgttgagtgctgagtggcttcctggtggcgagcttgctgtccacatat
aatccaaggcaggaagactttctgaacaaggtccttagagtcccccgctccacatggatt
gggcgatgaacccggagatctgaaactgccctcacacatgtgcttctcttggccccgcag
CCTGGCCGGGGTCTCCAGGAGCGTGACACTGGTGATCGCATACATCATGACCGTCACTGA
CTTTGGCTGGGAGGATGCCCTGCACACCGTGCGTGCTGGGAGATCCTGTGCCAACCCCAA
CGTGGGCTTCCAGAGACAGCTCCAGGAGTTTGAGAAGCATGAGGTCCATCAG
gtaagcagttcttaggggacatcagagatgcaggcaggtgcccctgaacggtgcccacag
tctttccgtacacagccagcatcatggcgtttggagttgaaaggcccacagaggacatcg
gctcccagggcgcccagctgcaccccttcagaagtcgtcacgatccctcgtgcacctgtt

 1.21 Term +  57735  58055  321  2  0   61   42   213 0.712   8.82
tgttgaagccacaggcgcctaccctttgtcattctccttgtgcctggtactccctactag
tttgtttctctccctttgggtgacgtaccatttccttggtctggcctattttcatgtcct
aggccagcaccttgaaggagcagttccttctcttgcttgaccctggctggccaaccacag
AGCTCTGATTTCCCACTGCTGTTTGTTTCCCTGGTTATGTGTGGCACCATCTCTGTGGTG
AAGTCACAGGTGCAAGCCCACGTGGATGCAGACGTGCACATGTGTGTGACGTTTCGGGTT
TGTTTCCATCCTCTCCAGTATCGGCAGTGGCTGAAGGAAGAATATGGAGAGAGCCCTTTG
CAGGATGCAGAAGAAGCCAAAAACATTCTGGGTAAATATAAGGAGCAAGGGCGCACAGAG
CCCCAGCCCGGCGCCAGGCGGTGGAGCAGTTTTCCGGCACTGGCTCCGCTGACCTACGAT
AATTATACGACGGAGACCTAA
cgcaagcgacctgctgccttccttcccactgcttgtcttcagtgtgcccggctgggcagg
ggtgcggtggtggtggccgatgaggacaggaaagggagatagccagggcgaggtggggcg
agggctccttcccccaagcaacaccgcccagccctgctccaggcccctgcactccgccca

Predicted peptide sequence(s):


>DUSP22_1|GENSCAN_predicted_peptide_1|1140_aa
MLMLQPVDTECATSPAASVAKEDTLGYPCSRRADLLHVGHTHVAAKAYVSSACTGLECQM
AEASSERNAEALLQDPAIAVTEILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPML
EENLFEATQNQWYFAVPKAYSSFRVLRQICLKPTPDLNRYDSNRNDYSRDRKLSSNRSFL
KQAVSRFLVWQSGAVDTGKGRLGDVNSKSEMLSEEMQFCKAFEREDRLRLVETTKENIRG
EHPRRERVFLVPGRDSTVCGWLTSRKLKHHGGGGDGRGHLVQGDSVGYGCLVGRGGAFES
AIGSLNGKLKGVVLYLLVPRESSALGFCVLVCAVLYLLVPGESSALGFRVLVCAVLYLLV
PGESSALGFRVLVCAMLYLRVPGESSALGFCILCCICWCLESSALGFCVLVCAVLYLLVP
GESSALGFRILVCAVLYLLVPGESSALGFRVLVCAMLYLRVPGESSALGFCILCCTCWCL
ESSALGFRILVCAVLYLLVPGESSALGFCVLVCAVLYLLVPGESSALGFRVLVCAMLYLL
VSGVIFPGLLRPVLYLLVPGESSALGFCVLVCAMLYLLVPGESSALGFCVLVCAVLYLLV
PGESSALGFPVLVCAMLYLLVPGESSSLGFCVLVCAVLYLLVPGESSALGFCVLVCAMLY
LLVPGVIFPGLLRPVLYLLVSGESSALGFCVLCCICWCLESSALGFRVLCCICWCLESSA
LGFCVLVSAMLYLRVPGESSALGFRVLVCAVLYLLVPGESSALGFCVLGVKYLCIPAADS
PSQNLFAFAFLAALRTDTALSDQKETHTEQTSVGTAVRDSVLAPLGGHSSPARRAGTQCK
PPGKLQTSSLEPLLGQMSWLKVSNIFELVADIRPADFSANRRRLVVLKGFVLVVTLAVVA
EHVCACLRVHVCVCMFACGCMHMDSCCCSLAVLISLSTCREVAEFLLQSVPGTRHFKESI
KFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGF
QRQLQEFEKHEVHQSSDFPLLFVSLVMCGTISVVKSQVQAHVDADVHMCVTFRVCFHPLQ
YRQWLKEEYGESPLQDAEEAKNILGKYKEQGRTEPQPGARRWSSFPALAPLTYDNYTTET