GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:04:46

Sequence DTNBP1_1 : 142567 bp : 40.06% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1309   1364   56  0  2   78   63    76 0.489   5.09
ggcgggaacgcggaaggggctggggttgcggcgcggcggcgaggaccagaccgggggcgg
ggccggtagtgggagtgcggggcgcgcggtgacagcgcggggttggcggcgtgggaccca
gggggcgacagaggcagcagcagcccgaggcctgaggagaggagaccggcggcggcggca
ATGCTGGAGACCCTTCGCGAGCGGCTGCTGAGCGTGCAGCAGGATTTCACCTCCGG
gtgggtatacggtgggcgacgaaaagggacctgagggggccgggccgccgcctgggatgc
ccctgcctcgctcccttccccgcgccacggtccagggtccgtcctgtcccgcacctcccc
gccccgccccgccgaggaaagtaacgaacttcccggcgtcctcgcgtcgggcggcgcaaa

 1.02 Intr +  26374  26434   61  1  1   98   88    26 0.024   1.42
ttgtcacagatttggccactggaagctctgtcaagttgacgtctgtgtccttgcaacatg
tccccattattttttgagtgtttcctttctagcaccacaggatattccacattcatcttt
agatagtatttccttttaatgtgtggtttgcatttcaaattattttttgcttttttttag
GTATGAGGATACATGGGCTGCACTTCACAGAAGAGCCAAAGACTGTGCAAGTGCTGGAGA
G
gtaaagaattgactaatcttatactcgtggcaaactttcctttttcagtgctaaatggta
ttttttaaaaattgaatttataattgtttgtgtcaaaatgttttgcaggatatctgaaat
tgaatctagtcgttgattatgaaactccctgaataaagcacctttttatcatttctctgt

 1.03 Intr +  36703  36835  133  0  1   92   80   130 0.162  11.90
ctgaatattaagttgtttcttttctaaaaatgaaaacaacttcagtctcttttagaatgt
accgtaatctctactgagtagaggggttgttaaagataacattaaatctcattacgttaa
ctgtactttctttgtgcctaaaacctggtttcactttaccccccttcttgtgtgctgcag
CTGGTGGATAGCGAGGTGGTCATGCTTTCTGCGCACTGGGAGAAGAAAAAGACAAGCCTC
GTGGAGCTGCAAGAGCAGCTCCAGCAGCTCCCAGCTTTAATCGCAGACTTAGAATCCATG
ACAGCAAATCTGA
gtaagtccaatgttttcattgtacattacttttaggaatgaaaacaacttgggcagggtt
tggtgtaatttcagagcttttcaggaacacatgaaattctgggttaacaggattttttgg
aaaatcatgatttcatattttgattagttgaggattccacagaaaatgatgtaaagtgta

 1.04 Term +  40008  40123  116  1  2   91   47    96 0.887   3.55
tcgttttaaaaataagtaataagggtatgctgggaactggaaaacaagggctatgaactg
acagatcgggtttggctcccaatccaacttcctcactttaaaaactgtgcagatttctca
atggctccaagctttagttttcttgtctgcaaaatgacgatgagcatacctgtcttgtag
GTATTTGGAGGATTAAAGGAGATGACAAACGTAACCACTTAGCACAGTGCCTGGTACATG
CTGGGCATCTGCCACGCACCACGCACTGCGTACAGACTCTGGACACACAGCAGTGA
acaaggctgggcacctgccatcaagatgctgacgttctaatgggggcctctctagccttt
gcgaattcacaaaaccattattctgtgacacgagggtttggatggatgttaggcagttta
gcttgtgctgcaaaacagtttagaatgcaaaaccacaagattcaatgtggtgatattagt

 2.09 PlyA -  41803  41798    6                               1.05
 2.08 Term -  53285  53135  151  1  1   29   48   248 0.953  11.30
 2.07 Intr -  54530  54062  469  0  1   85   67   145 0.310   3.33
 2.06 Intr -  59844  59773   72  1  0   74   42    80 0.294   0.46
 2.05 Intr -  85391  85282  110  1  2   15  110    48 0.115  -1.29
 2.04 Intr -  86205  86132   74  0  2   83   83   135 0.078   9.79
 2.03 Intr -  89169  88986  184  2  1   53   69    64 0.016  -0.13
 2.02 Intr - 103438 103219  220  2  1   54   75    71 0.140  -1.16
 2.01 Init - 105132 104844  289  0  1   64  115   401 0.911  37.72
 2.00 Prom - 110539 110500   40                              -5.65

 3.01 Init + 112170 112526  357  2  0   39   66   208 0.091   9.22
taacgtcactttttattgaactgaatcttaagtgcaggtgtttttggatacctcctgcac
tgattccatggaccagtctgatgtcattgtccgttgcctgttcctgagagccccttgtag
ccacttcctgctcccacttttagccatgaggattgtacttgtttgtttccagcccataga
ATGGCATGCTGGTGTTTCCCGTCAGCTGTGCTGCTGTTTCCTGAGCTGTGTGCTGTTTAT
CTTCTGCATCACTGCACCTCAAACGTCTGGCCTGCTGTGACTGCTGGCTGTGGCTTTGCG
ATCAAGCAGCCAGTTGAAGGCCTACTCCTGTGTACTTGTGAGGCTGCTCCTGATATCTGG
CGTTTACTGTGCAGTCCCCATTTAGTGATTGCTACCAGTACCTTCATCAGACTGTTGCCG
AGCGCCAACTCCATGACAGGCACTAAAGCTTCCATGTTGAAAGACACAGTGCTTGCTCTC
GAGGAACGTGGCATCCAGTGGAACTATAGGGGGCAAGTGTGTGGTAGCAATGGAGAG
gtaccagctatgtgggagcgtggaggaaagagagcctgggtctccctggcctgtcagaga
agggggcagtcgagctgagatgtggagggtgagtggaagttggctgagtgcaggcgtctg
agcaaagggtcaaggcaattacaagtcagggcatggcttctttggagaaccatcaggtgt

 3.02 Term + 124253 124492  240  1  0   41   54   251 0.539  12.04
gattttcagtgcatagtgagtcctggttcttggtaatatttggtgttgctccctcttcaa
gaggctgttgtttaaataatgctggtattaatattagctgccagctattggccaacattg
tatgcttggtgattcgtatttgctacctcatttaatcctgccaacaaccttacgaaatag
GTGTTTTTACCGCACTTGTATGGAGGAGAAGTTGCAACTCTGGTGAAATCAGTTATGTGG
AAAAAGAGTCTGAGACTAAATCCTGAAGAGGATTTAGCTGCAGGTCCTTTGGGAGGCGAT
TCCAAGAAGCAGGAGCGAGGGACAGGGAAAGTGAGACAGCGAGGAAAAGAAGCTAAAAGC
AGGAAGCTGCTAAAGCCAGTGAGGATGTGCCGTCGTACCAGGATCTCTGAGAAGTGTTGA

gaacgcctcctagaatcgtccacccaaaggatgttagaccagggtcctgagacactgacc
tctgtcacatgttggttgagaactgccttaattccacaaaactgggctgtgctggctagg
ttccctgagattcagagaatactctgaccagaaaaacagccacacaggcgtggctgtgag

 4.01 Init + 130507 130594   88  0  1   23   91    99 0.640   4.55
cagtcttgcagggactccaaatccttagcaattgcactgcaatttttgtaagtcagctgc
aaaagtctaaacacagggatgtggaaacatctggatggagcagcagactccactggagtt
agtagaaggacgacctgagaagctggtcttggaaggtgaacagctgtttgtgactgatga
ATGGGCGATGCGGGTGGGAAGGTCGTTCCAGCAAAGGGAACAGCACATGCAAAGGTGTGG
AACGAAGGGCCTGACCCTGACCGCCCAG
gtagggggaggaagtgcagcagattgggggacaaggaggccagctgtacacgcagtcggg
gcaccagcccagtctgtaaacgcggcatgactccatccacttggagggtggatgcgagca
gctgtttatacccatttcctctctcagtcccttttcaaaccctaaccccagttattctgt

 4.02 Intr + 130783 130987  205  2  1  107   -5   317 0.046  21.64
aggaagtgcagcagattgggggacaaggaggccagctgtacacgcagtcggggcaccagc
ccagtctgtaaacgcggcatgactccatccacttggagggtggatgcgagcagctgttta
tacccatttcctctctcagtcccttttcaaaccctaaccccagttattctgtttcctcag
CTGAACTAGATGCAGAGCACGCCCAGAAGGTCCTGGAAATGGAGCACACCCAGCAAATGA
AGCTGAAGGAGCGGCAGAAGTTTTTTGAGGAAGCCTTCCAGCAGGACATGGAGCAGTACC
TGTCCACTGGCTACCTGCAGATTGCAGAGCGGCGAGGCGAGTGGGGGCTGGGGCTGCTGG
TGTGGGGACTCACCGGCTGTGCGGG
gtggcgatggacccctctccccagagcagggcatggggcagaatcctcagaagttccgtt
ctgttatgagaccccagcaaccaaaatgtgtgcgtcgggccacctctctcttgccctgct
tttgcctcttctatcagtctaagctttagttgaagatatattttttttaatacctctaaa

 4.03 Intr + 136003 136097   95  1  2   67   92    68 0.143   3.79
cagaggccagggatgcagttaaacaccccacactacccaggacaccccacaaccaagaac
gatctggcacaaagtgtcaggagtgctggagctgagaaaatgttttctagtgaagcttga
gtctgctggagccattcctgacctgctctgcacatctgtgtgcatttattttcttcatag
TTGCCATGACTCTTCTTGGGGTCTTGTCCGTTGGTATAAGTGTTACAGTTTCAAGTTTGT
TGACGAACCTTGTCTACAGTTTGAGCGGAATTGCA
gtaagtttctgcacggagacacactggacctcttagtggtattggatctttctgcaagtg
cacgtgtctcatgcattcctgagtgttgagtagaacttgcctccaatgctgttaccagtg
actactctatttgaagagttacctattctttttttctgatagttatagagatttactatt

 4.04 Intr + 139509 139714  206  1  2   89  100   290 0.154  28.30
tgatttaggatgcatttaaagtgccagactggcatatgtcatctactaatacgttgcttc
aaattccattttgaaggaagcttaggaaatgcaatgtagttagcctaatgccaatggaag
ttcaccttttaaagtaatattaaagacagcgtgtcctttctcgtgttgatctatccgcag
AGCCCATAGGCAGCATGTCATCCATGGAAGTGAACGTGGACATGCTGGAGCAGATGGACC
TGATGGACATATCGGACCAGGAGGCCCTGGACGTCTTCCTGAACTCTGGAGGAGAAGAGA
ACACTGTGCTGTCCCCCGCCTTAGGTAGGGTTGACAAACTTGCATTAGCTGAACCAGGGC
AGTATCGATGCCACTCCCCTCCAAAG
gtgagacgtgagaaccatctgccagtcacttacgcataaacccccaagctcacagccagc
tcctggctccctaaccccacggttccacacggctgtgtggcagctgcaacagtggtgtgg
ttccgtcatgaattcttctcaaagatttgacatgctccactccggtaactttggtgagtt

 4.05 Intr + 139818 139887   70  2  1   61   97     7 0.324  -3.26
tgtcccccgccttaggtagggttgacaaacttgcattagctgaaccagggcagtatcgat
gccactcccctccaaaggtgagacgtgagaaccatctgccagtcacttacgcataaaccc
ccaagctcacagccagctcctggctccctaaccccacggttccacacggctgtgtggcag
CTGCAACAGTGGTGTGGTTCCGTCATGAATTCTTCTCAAAGATTTGACATGCTCCACTCC
GGTAACTTTG
gtgagttgagagctttcttgtttgttttccctcctttaccacccagaaatccatttgagt
ctgctccttgtggttaaggactggcgtttgcagggaggtgcggactctcctgcggggctc
acgggaaactcttccctcttcgtgcgacaggcatttaggggcgtgcctgccatgggcaaa

 4.06 Intr + 139934 140073  140  0  2   72   66   120 0.534   7.46
acccccaagctcacagccagctcctggctccctaaccccacggttccacacggctgtgtg
gcagctgcaacagtggtgtggttccgtcatgaattcttctcaaagatttgacatgctcca
ctccggtaactttggtgagttgagagctttcttgtttgttttccctcctttaccacccag
AAATCCATTTGAGTCTGCTCCTTGTGGTTAAGGACTGGCGTTTGCAGGGAGGTGCGGACT
CTCCTGCGGGGCTCACGGGAAACTCTTCCCTCTTCGTGCGACAGGCATTTAGGGGCGTGC
CTGCCATGGGCAAAGCCATG
gtgtgtgttcagctcttggcctgtgttgtaaacttagttgcacttcagttcctttcatcc
cttcacaaaattttgtttcacattcatgcagcaaatatgggctgaggtgccagacctgta
cctgggcttggtgcgtttcaaatttcagaccagttctttgggctgggtcaaggcaaagct

 4.07 Intr + 140811 140838   28  2  1   59   51    31 0.470  -6.73
aaggttacaaggactgctcctcaaagataggcagcacttgcctttgggcctctattacac
gcgtattacagccttaggagcacttgatctgtgtcacatgtggctgactccttaggggac
agaagggtcaccgcagggcctgaggctgcctctggcatcgctcagctcagtgtcttccag
GGCAGTTCCCAAGTTCTGCAGGCCCCAG
gtgcctggaacaaaaaccacacccccctttcatgacgggcacattccacagctgttggcg
gcaattctgattcacaatatttttatgacagggctttttcttccctacgttattttgcag
ggcctgaatccagtacctgtcagaatgagattaccctccaggttccaaatccctcagaat

 4.08 Term + 140959 141203  245  2  2  109   32   320 0.948  23.58
cctctggcatcgctcagctcagtgtcttccagggcagttcccaagttctgcaggccccag
gtgcctggaacaaaaaccacacccccctttcatgacgggcacattccacagctgttggcg
gcaattctgattcacaatatttttatgacagggctttttcttccctacgttattttgcag
GGCCTGAATCCAGTACCTGTCAGAATGAGATTACCCTCCAGGTTCCAAATCCCTCAGAAT
TAAGAGCCAAGCCACCTTCTTCTTCCTCCACCTGCACCGACTCGGCCACCCGGGACATCA
GTGAGGGTGGGGAGTCCCCCGTTGTTCAGTCCGATGAGGAGGAAGTTCAGGTGGACACTG
CCCTGGCCACATCACACACTGACAGAGAGGCCACTCCGGATGGTGGTGAGGACAGCGACT
CTTAA
attgggacatgggcgttgtctggccacactggaatccagttttggctgtatgcggaattc
cacctggaaagccaggttgttttatagaggttcttgatttttacataattgccaataatg
tgtgagaaacttaaagaacagctaacaataaagtgtgaggacggtaaactgagagcgcac

Predicted peptide sequence(s):


>DTNBP1_1|GENSCAN_predicted_peptide_1|121_aa
MLETLRERLLSVQQDFTSGYEDTWAALHRRAKDCASAGELVDSEVVMLSAHWEKKKTSLV
ELQEQLQQLPALIADLESMTANLSIWRIKGDDKRNHLAQCLVHAGHLPRTTHCVQTLDTQ
Q

>DTNBP1_1|GENSCAN_predicted_peptide_2|522_aa
MGHKAVETTRNIHNAFGAGTANELTVQWWFKKFCKGDKSLEDEEHGGQPSEVDNDQLKAI
VKADPLTTTREVAKELNINHSVVIQHLKQIGRVKKHGSGGPGYLGTLKEGNNLSNSHRYL
QAQTPGWAQTFNKKSTLRFLTEESSIKANLKRAYTAKIILAALYTNNQARALDTAILAQT
VLFQKPVMFSLCSFYTNRIHYRKAKLRVTFMKTFFKKLIWAIPVLNLKEKKAKGIKEKNS
EVCGQYEQLPDDSAERYVKKMLNITNHQGNANQNHSEVSSPTVRMAIIKKTKASKQTSAA
ELQKLVTALLLGSFREVSRSSAGFKQYCLLAYSLRISVVFILEAFLIEYDSSAVYLYLSE
ATKVDSKLCRVWAQHQRVVRADLAVSPHTYNLNIHICRPFLVGWSSAVLQMNAPFFRTGD
VSLAAGVLGPTGEKGLNSLIVYYVGFHLVPLFSIHLYVYLSSSVLESSLEPLSKVQGEAA
SADVKAAAAYPEDLATITDEGGYAKQQIVNRQNRLLLEEDDT

>DTNBP1_1|GENSCAN_predicted_peptide_3|198_aa
MACWCFPSAVLLFPELCAVYLLHHCTSNVWPAVTAGCGFAIKQPVEGLLLCTCEAAPDIW
RLLCSPHLVIATSTFIRLLPSANSMTGTKASMLKDTVLALEERGIQWNYRGQVCGSNGEV
FLPHLYGGEVATLVKSVMWKKSLRLNPEEDLAAGPLGGDSKKQERGTGKVRQRGKEAKSR
KLLKPVRMCRRTRISEKC

>DTNBP1_1|GENSCAN_predicted_peptide_4|358_aa
MGDAGGKVVPAKGTAHAKVWNEGPDPDRPAELDAEHAQKVLEMEHTQQMKLKERQKFFEE
AFQQDMEQYLSTGYLQIAERRGEWGLGLLVWGLTGCAGCHDSSWGLVRWYKCYSFKFVDE
PCLQFERNCKPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGRV
DKLALAEPGQYRCHSPPKLQQWCGSVMNSSQRFDMLHSGNFEIHLSLLLVVKDWRLQGGA
DSPAGLTGNSSLFVRQAFRGVPAMGKAMGSSQVLQAPGPESSTCQNEITLQVPNPSELRA
KPPSSSSTCTDSATRDISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGGEDSDS