GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:54:28

Sequence DAAM2_1 : 114254 bp : 47.66% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.05 Intr -    850    610  241  0  1   23   80   112 0.051   1.45
 1.04 Intr -   1533   1273  261  2  0  116   63    87 0.128   5.60
 1.03 Intr -  17629  17587   43  2  1   61   92    33 0.122  -1.70
 1.02 Intr -  21300  21229   72  1  0  114   47    74 0.879   5.28
 1.01 Init -  23070  23001   70  0  1   59   69   105 0.901   6.91
 1.00 Prom -  37020  36981   40                              -1.36

 2.01 Init +  60754  60911  158  0  2   75   57   156 0.518   8.66
agctcagagcccagggaaaagcacagctcccctggcctagaggaaggcagagctgggtga
cttcataaatctggccaggcacattcccagaatgccaggcctcggtcaccccatcattgc
ctggagaagcgctgaggcttgcaggctctgggcagggcgagtcttaccttgctggcgatg
ATGGGAATGGAGGCCCGCTGCAGGGTGGCGCTTCCTCTAGTGTCGCCCAGTGTGCTCCAA
GCATTTCACTTCTATTACTTCCTGTACTCCTCACTGAAACCCAGCGAGGAAGACCCTGTG
ATCAGGGTGTCACGGATGAGGAAGCTGGGGCTTCAGAG
gtgaagagtactcatgggcactagctgagaacacaaaggtgggggaatcccagtctcctg
acttcaaagcctctgctccctaccccaccctgctactaggaagctggagtgaaagaggtg
tcagagcaggagcgggtgaggaattagggttcagatgatggaagcagctcctactgatga

 2.02 Intr +  61829  61842   14  2  2   55  116    11 0.487  -4.98
tctcctgagggccactgtgcctcactccccgtactcaggggagatgctctaatatttaac
aacaggtatggcacaggccctggccagtcagagcaatcatggctgtaaacagccggtgta
agactgtgccaaggtgcaccagctatatgccacccctgctgccatgtctgattcctctag
TAGAGCCAAGAAAG
gtaagagggagactagggaacaagaggctggggaagtaaaggcagaaagaggggtcacag
gttctccttgtccctccctcatggtgctgtcatcccagcctccccgctgcctctcggagc
tcccttcccatgccttgtgccctgaacaaagcagtcttgcttgccagctgcagctgcgtt

 2.03 Intr +  64430  64653  224  0  2  118   49   291 0.454  26.05
agctggagggaacagagggatgctgtgggaggaggggcgacagcggggtgggtggggctt
tgctattgggttgagggctcccagcaacctgtgggacagaggttatgaaggcagagtgac
ctctgccctggcctatctgactgtatgcctgaccaccctgtgttctctcctcttgtccag
ATCACAATGAGGACCTAGGGCATCTGTCTGCTGACGCCCCCTGGCCTGCAGTGACCATGG
CCCCCCGCAAGAGGAGCCACCATGGCCTGGGCTTCCTGTGCTGCTTCGGGGGCAGTGACA
TCCCCGAAATCAACCTCCGGGACAACCACCCTCTGCAGTTCATGGAGTTCTCCAGCCCCA
TCCCGAACGCAGAGGAGCTCAACATCCGCTTTGCAGAGCTGGTG
gtcagtgagagggtggggagagacagtgacaatggggaggagggtggatggagaggcaga
gctggacagagggcagggcccctgtgctggggtctccatctctcaaaactcctcttggga
ggagataggcccccaggacacctcagctatgttggggaaccagagtctctcactgggatg

 2.04 Intr +  69111  69200   90  2  0  107   44   113 0.932   8.99
gatggggctgtatctctgatagaaaaagaaatgccctatcatatctttgatgctcttcgg
gaggaagatagtagtagcctgaggaactgatttgggggaattgtaatttcctgcagggct
gactattctaatctcaaccatccctagtgtcagacgtattttttcttattgtctttgcag
GATGAATTGGATCTCACTGACAAAAACCGAGAGGCTATGTTTGCACTGCCCCCTGAGAAG
AAATGGCAGATCTACTGCAGCAAGAAGAAG
gtgccctctctgacccctctggccacatctcagggttcatggcatggggtggctcttgct
gccttggcatgctcatgcattcacctgatgtttattacatgccagccctgttctaggtgt
tggaggaacaacagtgaataaaatagaaaaaggaaattctgctgtcctggagcttacact

 2.05 Intr +  72616  72690   75  0  0  119  101   118 0.999  15.91
tcatctgtatttcaccaagggagaaatggaagcctgggggagagtgtaatttcctccaac
ccacccgacatgggcagagctgagaaatgaatccctctgctgacacggaatgaagctcag
gatctcaggccacgggcctgtcttgcctgttggtccatgctgtcctttttcttgtttcag
GAGCAGGAGGACCCCAACAAGCTGGCAACCAGCTGGCCTGACTATTACATCGACCGCATC
AATTCCATGGCTGCG
gtgagtggctgcccctctcctgccctgcccccacctggaaaggctacggcagggagtgat
tcccccagcccccaccccccacacaccaaactgccttttactgctcctcagcgccccact
gcccactcactggagttcagcagctttccagttattcatgaaattttaaggtaatccacc

 2.06 Intr +  73163  73257   95  1  2   88   76   145 0.988  12.06
atgaggaaagtgaagtcccagcccagaacctaggtcttcccaggggccgacactcggtct
cagtaaaccattccctgaggcctcaccctttctgaggcaagcatggcccctgggtcacac
ctgagctgtagtgcagagggttgggagacaggcagcccctttctacctgctggccctcag
ATGCAGAGTCTGTACGCGTTTGATGAGGAGGAGACGGAGATGAGGAACCAAGTCGTGGAA
GACCTGAAGACAGCCCTCCGGACACAGCCTATGAG
gtaattcagtttccccctcttgcttcctgctgagtcccttcacagttggtctccttgcct
tcccgaagccctgtgcagtgctctgctcccatgccggtcctcctggccaactctgcctca
cctgacttcacttcccagcccctactcctctcctgggaggctgccagggcttgggaggag

 2.07 Intr +  75693  76026  334  0  1   41   94   401 0.994  31.57
gacacaagtcttttgtgaagatgataggatttcactgctttagataaactacgaataaac
caagtggctactgtaggtgggacaaggtgcatggtggtacacaggtaagggggtaactat
ttgcaaagtgtacacagaatcatatgcaaatatatgtttgttaatggctctgatttgtag
GTTTGTGACCCGCTTCATTGAGCTGGAGGGCTTGACCTGTCTGCTAAATTTCCTCCGGAG
CATGGACCACGCCACCTGTGAGAGCCGCATCCACACCTCACTCATTGGCTGCATCAAAGC
ATTGATGAACAACTCCCAGGGGCGGGCACATGTGCTGGCACAGCCTGAGGCCATTAGTAC
CATAGCCCAGAGCCTACGCACAGAGAACAGCAAGACCAAGGTGGCTGTGCTGGAGATCCT
GGGTGCTGTGTGCCTCGTGCCTGGTGGCCACAAGAAGGTGCTGCAGGCCATGCTGCACTA
CCAGGTGTATGCAGCAGAGCGAACCCGCTTCCAG
gtgaggggccaggctggaggtgggatgccagctgggtggggcagaggatgtcacatgtga
gtgagagcctgaagattctttgcagcagaaactgggggaaaaggaaagtaatgtggtctg
catgcctgctcctggaaggtaacaggtgaagagtactgggacctggaaggcttgcataaa

 2.08 Intr +  77006  77116  111  1  0  101   59   248 0.999  23.78
ggaattttccaggcagaggtgaggtttggggcagcccagagtaaattggacagacctgat
tgggtggagagagcagatggggcattctaggtagtggaggcgacaggagtaaagatgcaa
aggccacacctgttgggaactcagccctctcctcctgctctgtcctgcatttccacctag
ACCCTGCTGAACGAGCTAGACCGAAGTCTGGGCCGGTACCGGGATGAAGTGAATCTGAAA
ACAGCCATCATGTCCTTCATCAATGCTGTCCTCAATGCTGGAGCTGGAGAG
gtggggtgccttctccttgcccttgctgttccctgactttctggacctggggtagagtgt
gtgagtgtgttgcttccccaataattgtttttgctattaaacctgggagggctcctgggg
agttgcctacataggtagcatcatgcacggtggacagacccagagctgagctggctgatg

 2.09 Intr +  78523  78626  104  0  2   71  108   159 0.999  15.17
taaactaagaaataaggtctccattctttcttggaactctgggattggaagcagctccag
gtgagttagctgtgggagatgtgttgggtctgtggctagggtggtgatgagggctccact
ggggatgttgtggaaactgagatctgccaatgagtctggccctcccttggtgacccccag
GATAATCTGGAGTTCCGCCTACATCTACGGTATGAATTCCTGATGCTGGGTATACAGCCT
GTGATTGACAAGCTCCGGCAACATGAAAATGCCATCCTGGACAA
gtaagttccaagcacccgtctccattgcaaacctgtggggacagtgcctcagatggggat
agttgggacctttgtgaaggctgcccttccctctggagaccagctgccattcccagcgca
gattcagaatcagctctgtggggggaaggggtgcccttgcctgtcctctttgctgacctg

 2.10 Intr +  79689  79755   67  0  1  101   77   105 0.999   9.61
cttataaagggcagacaatgggtgtcctacaaacagcggcttctttcccattttgccttc
attttgcttgaatgaagctttcagatttagccagtggggggctcgaaggggctgtaaccc
tcaaccaagggtgtgtcctggctgtaatgtctactctctctgtctccccattctgtctag
ACATTTAGACTTCTTCGAGATGGTGCGGAATGAGGATGACCTGGAGCTAGCCAGGAGGTT
TGACATG
gtgaggagccagcagggtggagcgattgcaatggggtagtagggttcttggtggccccac
agccacttttctagaccccgtgttgtggcagggctggtgtgggctggttccctggtgggc
acccccatggccaggtcctgtgatcagtcatagttcttcatagaaacacaaccaatagga

 2.11 Intr +  81421  81538  118  0  1  148   95   206 0.999  27.34
tttataaaattgactatctccctgttccttttgtctttctctttttaagcctgggccaga
ggcaggggaagaaaacctttcctatgagacagggcatagtggatggaagcagggtcttct
ctctcctgctgacttcctctgctgcctacccactgatcactgtgccctcttctctcccag
GTCCACATCGACACCAAGAGTGCTTCCCAGATGTTTGAGTTGATCCACAAGAAGCTGAAG
TACACGGAGGCCTACCCCTGCCTGCTCTCTGTGCTGCACCACTGCCTGCAGATGCCCT
gtaagtaccctgcacttgctgcttccctcgactggcctgaaccttgacttggggcaggtt
tagacaagactttgggacctccctggtttggggagtctgaccatgtctccctgtgcactt
gcttttgggagggcaggccccatgacggaggcccctgcttttccttccctccttggggtc

 2.12 Intr +  83513  83651  139  0  1   58   58   268 0.999  20.32
gatgactgaatcagtgagttgccattatcagcaatggcattgcctcttcttctagactgg
gagcttaccataggtggagaagggcatgcctcaccagccagaccccaggcagcaactcta
gggtggggcccaagggggacttcaggactcaggaaagatatgatacctgtcatccctcag
ACAAACGGAACGGTGGCTACTTCCAGCAGTGGCAGCTCCTGGACCGCATCCTCCAGCAGA
TTGTCCTCCAGGATGAGCGGGGTGTGGACCCTGACCTGGCTCCCTTGGAGAACTTCAATG
TCAAGAACATCGTCAACAT
gtgagcagtggccagcctttgccctgtcttcctccaccttcctcatcactctcccactct
ggtctcaccagcgaaacctcagctccctttcgcaacccagtcatcccgaaatgagtcttg
ggcagcatggtccaacagaactctctaagctaatgaaaaaagtgcatttctctactgttc

 2.13 Intr +  86386  86444   59  1  2   77  100    87 0.999   7.33
tgtgaacggggcaggggacctggagagacacctgggaagtctaaatcctagcccccttga
tgtggctggacagattggagaccagggtccccacctggagggtagaaagatgatgtctcc
tgggaagctgtgaatcaatggtcaacaatcacattgccccttccctctatgccctgccag
GCTCATCAACGAGAATGAAGTGAAACAGTGGCGAGACCAGGCAGAGAAGTTCCGGAAAG
gtgaggggctctgcttaagcctgctgtccactccacatgcccttcccctgcccagcccat
aactccatgcccttccaggcagggagtcacattactcacattctctccttctgtttcctc
tcccgtcccacccccattccagaacacatggagcttgtgagccgtctggagaggaaggag

 2.14 Intr +  86587  86747  161  2  2   96   28   203 0.511  14.81
gaaacagtggcgagaccaggcagagaagttccggaaaggtgaggggctctgcttaagcct
gctgtccactccacatgcccttcccctgcccagcccataactccatgcccttccaggcag
ggagtcacattactcacattctctccttctgtttcctctcccgtcccacccccattccag
AACACATGGAGCTTGTGAGCCGTCTGGAGAGGAAGGAGCGGGAATGCGAGACAAAGACAT
TGGAGAAGGAAGAGATGATGCGGACGCTGAACAAAATGAAGGACAAGCTGGCCCGGGAGT
CCCAGGAGCTGCGCCAGGCTCGGGGACAAGTGGCAGAGCTG
gtagcccagctcagtgaactctcagtatgcaagcatctccccctttacatagttgagcca
agaccctgggcttcaggactgggtgggcagagcaggtgtcggagaggccaaggaccccag
catgagggagaagggagatggagaccttgggccaggatagaagagacccttgaggctgta

 2.15 Intr +  87565  87660   96  0  0   92   83    61 0.952   6.21
ccccctgggggcccactcaccttgtcttcctcaatgacaaccaatgacctgcctccaccc
cctcctcctctgccctttgcctgttgtccccctcccccaccaccaccccttcctcccggg
ggacccccgactcccccaggtgccccaccttgcctcggcatgggcctgcccctccctcag
GACCCCTACCCCAGCAGTGACGTCCCACTCAGGAAAAAGCGTGTCCCCCAGCCTTCTCAC
CCACTGAAGTCCTTCAACTGGGTGAAGCTGAATGAG
gtgagcatctgggaaggggctggagggcccattcttctacagcagggcagtcagcctcag
ggaccacccgccccttgtttacagatctccactctgggtcctttctttggtggggggtaa
gggcagtcatgtggatgtacaaagtgggtttgctgtgccaggcagctcacggtcagaaca

 2.16 Intr +  92145  92252  108  2  0   40  110   156 0.995  13.48
ggagcagagtattcaagagagttggaggttgaggggagcaaccgactaccttctgaaggt
ctgaaatcctggtcatcttagtatgtgcagttgggagataagtggggttagggaggcatg
gagcatcttcatgatggagttgggccaaccatgggatcttctccctaccctgaattttag
GAGCGTGTCCCTGGCACCGTATGGAATGAGATTGATGACATGCAGGTATTTCGGATCCTG
GACCTAGAGGATTTTGAAAAGATGTTTTCAGCCTACCAGAGGCACCAG
gtaagaccctataccctctggcctcttggaccatacccttgaatccaaacctcagcttct
ccttttctttctgcctgcctgccttcctttcctttcctttccttccttcccttcctccat
cttccccttcccttccttctttccttccttcctcacatgtatactgaatgattttattct

 2.17 Intr +  95669  95775  107  1  2   73   55   183 0.978  12.51
ccagataccgtctcttaaagttagctattatccaccctcctctctctcctgtctttttct
tcccccttcccctcacaccaggagcattcctggattggtaggaggtggctcttgcggggc
gggtaagaggaggattagggaacccacacctcaactgtccacttgacttgttggttgcag
AAAGAGCTGGGCTCCACTGAAGACATCTACCTGGCTTCCCGCAAGGTCAAAGAGCTGTCG
GTCATTGATGGCCGGAGGGCCCAAAACTGCATCATCCTTCTTTCCAA
gtatgtgcaaaagaaggtggttgagttggatgcctgggggacaaagggggtggaggaacg
gagtggtggcagtctcgggcctctccctctctgctgtcccctgggaggggcaggcattga
tctggaactgtctctcgggaacctgccttgagcagcagtttggggctctgcaggcaggaa

 2.18 Intr +  96862  96946   85  1  1   20   94   152 0.978   8.82
tcaagtttgtggactgaatcatactagtctaatctaagaaggctttgtagaggaggtgag
gggggaatactattaaatatattcccaagtcctgttagggaatgagggaaggcggaggtg
gtaccttttggagaagaaggtttgagggctgtcctggattgaggtggggttttgccttag
GTTGAAGCTTTCTAACGAGGAGATCCGGCAGGCCATCTTGAAGATGGATGAGCAGGAGGA
CCTTGCTAAGGACATGCTGGAGCAG
gtgaggaccctcgtgggaaggaaggggaactgaacccagcgggcagccacgccccttccc
aacagcccccaggaggctgcgattcttgggtcaaggagaaatcaggctggaagagttagg
gagaaggtttatagaagcctccctgggccagcctttcttggggaaagctggaaaaggcta

 2.19 Intr +  99524  99630  107  1  2  100   47   228 0.632  18.91
cagagctgtgtgccctgtcatccccttcaggcagatgaaagaaatctgtccacatgaggg
tgcctccctctttcaaggcaccctccccatcttgacccaagtcagtacagcttctcacac
cctgtaccccatgtctgctgctcaccagttgcttgtgtgacttgcgcctgctctttgcag
CTCCTCAAGTTCATCCCAGAGAAGAGTGACATTGACCTCCTGGAGGAGCACAAGCATGAA
ATTGAGCGGATGGCCCGTGCTGACCGCTTCCTCTATGAAATGAGCAG
gttgggccatgggcatggtggggattcaagcaggtggggttctggcaggtggggcaggtg
gggctctgccaagaggaaggggatggaggtgggcaggcttgagaggagactggagctggc
tccgggagctggggctggccaggataggggtgggatacctcaagatatggttcaccttgt

 2.20 Intr +  99817  99905   89  1  2   82   97   163 0.999  16.21
ccatgggcatggtggggattcaagcaggtggggttctggcaggtggggcaggtggggctc
tgccaagaggaaggggatggaggtgggcaggcttgagaggagactggagctggctccggg
agctggggctggccaggataggggtgggatacctcaagatatggttcaccttgtctacag
GATTGACCACTACCAGCAGCGACTGCAAGCCCTCTTCTTCAAGAAGAAATTCCAGGAGCG
GCTGGCTGAGGCAAAGCCCAAAGTGGAAG
gtagggctgagggttgcaggaggcttagagtggagagttatctgagaaaggcagggtggg
tgggagccagtgaataggggcagagggaaacccctttcttattctcaacccaaaaacaaa
aacaaaaagtcaaagacaaaatctaaaatgatgattattataaaaatatgcacttgctta

 2.21 Intr + 104995 105163  169  2  1   88   94   244 0.999  24.00
gtgggtgaatgtgaaatcgatgggtctgctgaggagtaggtataatctctgcctcactga
gagttgaaggcatttgacagccccttttctgaactttgcggtggcatcttcctggggtgc
aatgagaactgctgccctgcctagcccatgcaggcctctgacctgtgcctcctctcccag
CCATCCTGTTGGCCTCCCGGGAGCTGGTCCGCAGCAAGCGTCTTAGACAGATGCTAGAGG
TCATCCTAGCCATAGGCAACTTCATGAACAAAGGGCAGCGTGGGGGCGCCTACGGGTTCC
GGGTGGCCAGCCTCAACAAGATCGCTGACACCAAGTCCAGCATCGACAG
gtgaggacctcccttcccggccacttccttggcctctatctcaccctaccctggcctctc
acatcctccctctattaggacgggaacatcctaagactcatcacccctttctcttaacac
tccatcctctgaccctctgaccctcgtgcccagtttcctctgtcacttaccactgacctg

 2.22 Intr + 105358 105465  108  1  0   96   61   107 0.995   8.20
tcccggccacttccttggcctctatctcaccctaccctggcctctcacatcctccctcta
ttaggacgggaacatcctaagactcatcacccctttctcttaacactccatcctctgacc
ctctgaccctcgtgcccagtttcctctgtcacttaccactgacctgactttcatccacag
AAACATCTCTCTGCTCCATTACCTGATCATGATCCTGGAGAAGCATTTTCCTGATATTCT
AAACATGCCTTCAGAGCTGCAACATCTTCCAGAAGCTGCCAAAGTCAA
gtgagggttctctccaagacttccttctccccatgatgaccctcattcttgtcttacttt
cctcttttggggtctactctgggcttgatgatggctggtgtgagacctcggttcttgtct
tctgagttcaaaagaatttaaacagacacacagcaaagggggtttagcatagaacaatgt

 2.23 Intr + 107060 107120   61  2  1  115   89    24 0.542   3.94
agaggcatgaaggggaggtgctttgtcagggccaacatcaatggccacaccagggctgga
acccaggctcaccgactcccaggccactgtgcttggctctgccctctccctgaaccagcc
ttagcacctcaaggcgggagttgatggtcctcattcccttccctctgtgtctccttacag
CCTAGCAGAACTGGAGAAGGAGGTGGGCAACCTCAGGAGGGGCCTGAGAGCGGTGGAGGT
G
gtgagtaccttgtcagtgcctacctgggtgagggctgctgtcagcaaacactgttcgtca
ctgcaccctaagctcctacacaggggcaaaaaacaatgggtacagcctctagcacagggt
cagccctcccaaaggataactggattactggggcttaagtttgagccttttaaaaggggt

 2.24 Intr + 108260 108391  132  1  0   84  116   213 0.947  24.54
ggtgggctggctgctaatgttagctcatagtctttgccatccttagaactttgagatgca
gggtgttccctcttccaaagggctcaatgtcctgtgagtgacgaggggagatgtggtgac
ccctgcacccgactctcatcttggcaccagtctaagcagcacttcaccctccctcctcag
GAGCTGGAGTATCAGAGGCGCCAGGTACGGGAGCCCAGTGACAAGTTTGTCCCTGTCATG
AGCGACTTCATCACGGTGTCCAGCTTCAGCTTCTCCGAGCTGGAGGACCAGCTAAATGAG
GCCAGGGACAAG
gtaagggtgccccaacccccactgcttgccaacccagccttatctaaacaagctccttca
cccattcctaccacagacagcccaggagggacaaacccagagttacagagctttgagaga
aaaccgtttcttcgctcttaacaagacaagcaatgataaccacataccgcaaagatcatg

 2.25 Intr + 109485 109655  171  2  0   84   77   278 0.999  26.44
cttgtctctgatcctgatgatgatgggggtgtcttctcacctcttccagccctgccccct
gtgccaacagtccccagccttgcgctgggctctgctctggctagaacccagctaacctca
ggggctgagcccagcatgctccagggcactctccaccaatcctgttctgtcccttgacag
TTCGCCAAGGCCTTGATGCACTTCGGGGAGCATGACAGCAAGATGCAGCCAGACGAATTC
TTTGGCATCTTTGATACCTTCTTGCAGGCCTTCTCAGAGGCCCGGCAGGATCTAGAGGCC
ATGAGGAGGAGGAAGGAGGAGGAGGAGCGGCGGGCGCGCATGGAAGCCATG
gtgaggggcagtgccaggcctgggactgaggggagacgggtgctacttggggagaacacc
cccaaactggggtgtgtgggaggagggcagagactgaggaactgaggaacaccatagggg
ttggatgtcagccccaggagagagaaacttcttcccagcctgagggaagagagtggtgtg

 2.26 Term + 109996 110220  225  0  0   80   43   351 0.999  26.58
tgagggaagagagtggtgtgaagctgggggcctgtatgtcctaggcaggaagaaagtggg
gccaacagatacaggcaggcagcatgaccatggcctaggagttagcccagggttgggggg
ctgccctggcctcagcgcctctccctgagagggttcctatctttggccccccgcccgcag
CTGAAGGAGCAGAGGGAACGTGAGCGGTGGCAGCGGCAGCGGAAGGTCCTGGCTGCAGGC
AGCTCGCTGGAGGAGGGAGGAGAGTTCGATGACCTGGTGTCGGCCCTGCGCTCTGGGGAG
GTCTTCGACAAGGACTTATGCAAGCTCAAGCGCAGCCGCAAGCGATCAGGGAGCCAGGCC
CTGGAAGTTACCCGGGAGCGGGCAATAAACCGGCTAAATTATTGA
cctggggaactagccacacaggaggccgggagacagggactggtgagaatggggctgagt
ggaggaggtggtgatatttaaaccatttggtgcttggtttagagccttgggctgggtcct
gggatggggggctgtgtgtggctggaccaggtgtctccccacgcttaccttaaggggctc

Predicted peptide sequence(s):


>DAAM2_1|GENSCAN_predicted_peptide_1|229_aa
MEEERDEYPVEFNLENFLEEEPREENVIRLVPSDELGRQAPRLWFVRARRNRADSQVYKQ
PCSDTSLYVRSLHLVWGTTRGTPGEPGTYLTVAMWQNQPSHSQATAGHRATASWPSPPPP
PLPSHPLHKITCRQTKSLIPRLSQSPDAWPWEPTPGSAAPANTLEKQNRQPAELLPPQAP
RGMLKKAEGEKCGSPAERAPRGPGPKTGSARAGRTYSEDPRAPALPQPE

>DAAM2_1|GENSCAN_predicted_peptide_2|1068_aa
MGMEARCRVALPLVSPSVLQAFHFYYFLYSSLKPSEEDPVIRVSRMRKLGLQSRAKKDHN
EDLGHLSADAPWPAVTMAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPN
AEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYID
RINSMAAMQSLYAFDEEETEMRNQVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSM
DHATCESRIHTSLIGCIKALMNNSQGRAHVLAQPEAISTIAQSLRTENSKTKVAVLEILG
AVCLVPGGHKKVLQAMLHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAV
LNAGAGEDNLEFRLHLRYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELAR
RFDMVHIDTKSASQMFELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRI
LQQIVLQDERGVDPDLAPLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLER
KERECETKTLEKEEMMRTLNKMKDKLARESQELRQARGQVAELDPYPSSDVPLRKKRVPQ
PSHPLKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDI
YLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAILKMDEQEDLAKDMLEQLLKFI
PEKSDIDLLEEHKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVE
AILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNIS
LLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRR
QVREPSDKFVPVMSDFITVSSFSFSELEDQLNEARDKFAKALMHFGEHDSKMQPDEFFGI
FDTFLQAFSEARQDLEAMRRRKEEEERRARMEAMLKEQRERERWQRQRKVLAAGSSLEEG
GEFDDLVSALRSGEVFDKDLCKLKRSRKRSGSQALEVTRERAINRLNY