GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:27:00

Sequence CDSN_1 : 7245 bp : 54.69% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    473    504   32  1  2  118   71     1 0.333   0.61
caccttcccaattagccttcttagcctcttgctcacccttgaggtctgggttaccagcca
tggggaggggctgtgagtggcctgtgagtaaccaaggcccagctttgacagaggtcatca
gcccaggcccctcccctggctgagccctggctcccagcacccccccccacccccgccacc
ATGCCGTCCCCAGAGGCCCCCAGAAGCGACAG
gtcagggagttggttttgggaatgtggtgccccatttctgagaaggagaaggttccccag
gtgatggaacacgtaataggtatgtggctggcctggtacttggggagtggtgggaggggg
agcctgggggatgggggcagaactcatatttgaaggaggaaagtggaggtggagtgatgg

 1.02 Intr +   1127   1299  173  2  2  133   91    52 0.836  10.10
ccggggccaggcctgtcaggtggcaggatcgttagagccccgtggccatgggtaccccac
actgcagccactgctgctgctgagtaggcagatgcaccgggctgattaccacgctcctcc
cggccacaccaacttcccccggggcacccaccccctccacctctcctcctctccccacag
TGACTCCTGCCCAGGGAATGTCCAGCTCTGGCATAAAGGACCCAGGTGTCCTCGAGCTGC
CATCAGTCAGGAGGCCGTGCAGCCCGAGATGGGCTCGTCTCGGGCACCCTGGATGGGGCG
TGTGGGTGGGCACGGGATGATGGCACTGCTGCTGGCTGGTCTCCTCCTGCCAG
gtaggaggctgggggccctgggaacaggagggaggcgggagggagactccgggagaggac
ccagcgaaggggacgggcaggggctctggaatctgccttttgagtctgggggttgctcct
cactgtatggtcgcctcaggtaagtttcttaaacttcctgagccccagtttctgaaattc

 1.03 Term +   4104   5608 1505  1  2  111   41   907 0.997  79.62
ttcggccacctcaatatcctttagagacaatagccagttcttcctcctttctccatccct
aaactctccctgcgctctgcttgggagaaacccgagaggccgattactgagataaggcag
aaaggtgagggaggaagccaagcctctttggcccttactaaccactgctttcctccacag
GGACCTTGGCTAAGAGCATTGGCACCTTCTCAGACCCCTGTAAGGACCCCACGCGTATCA
CCTCCCCTAACGACCCCTGCCTCACTGGGAAGGGTGACTCCAGCGGCTTCAGTAGCTACA
GTGGCTCCAGCAGTTCTGGCAGCTCCATTTCCAGTGCCAGAAGCTCTGGTGGTGGCTCCA
GTGGTAGCTCCAGCGGATCCAGCATTGCCCAGGGTGGTTCTGCAGGATCTTTTAAGCCAG
GAACGGGGTATTCCCAGGTCAGCTACTCCTCCGGATCTGGCTCTAGTCTACAAGGTGCAT
CCGGTTCCTCCCAGCTGGGGAGCAGCAGCTCTCACTCGGGAAGCAGCGGCTCTCACTCGG
GAAGCAGCAGCTCTCATTCGAGCAGCAGCAGCAGCTTTCAGTTCAGCAGCAGCAGCTTCC
AAGTAGGGAATGGCTCTGCTCTGCCAACCAATGACAACTCTTACCGCGGAATACTAAACC
CTTCCCAGCCTGGACAAAGCTCTTCCTCTTCCCAAACCTCTGGGGTATCCAGCAGTGGCC
AAAGCGTCAGCTCCAACCAGCGTCCCTGTAGTTCGGACATCCCCGACTCTCCCTGCAGTG
GAGGGCCCATCGTCTCGCACTCTGGCCCCTACATCCCCAGCTCCCACTCTGTGTCAGGGG
GTCAGAGGCCTGTGGTGGTGGTGGTGGACCAGCACGGTTCTGGTGCCCCTGGAGTGGTTC
AAGGTCCCCCCTGTAGCAATGGTGGCCTTCCAGGCAAGCCCTGTCCCCCAATCACCTCTG
TAGACAAATCCTATGGTGGCTACGAGGTGGTGGGTGGCTCCTCTGACAGTTATCTGGTTC
CAGGCATGACCTACAGTAAGGGTAAAATCTATCCTGTGGGCTACTTCACCAAAGAGAACC
CTGTGAAAGGCTCTCCAGGGGTCCCTTCCTTTGCAGCTGGGCCCCCCATCTCTGAGGGCA
AATACTTCTCCAGCAACCCCATCATCCCCAGCCAGTCGGCAGCTTCCTCGGCCATTGCGT
TCCAGCCAGTGGGGACTGGTGGGGTCCAGCTCTGTGGAGGCGGCTCCACGGGCTCCAAGG
GACCCTGCTCTCCCTCCAGTTCTCGAGTCCCCAGCAGTTCTAGCATTTCCAGCAGCTCCG
GTTCACCCTACCATCCCTGCGGCAGTGCTTCCCAGAGCCCCTGCTCCCCACCAGGCACCG
GCTCCTTCAGCAGCAGCTCCAGTTCCCAATCGAGTGGCAAAATCATCCTTCAGCCTTGTG
GCAGCAAGTCCAGCTCTTCTGGTCACCCTTGCATGTCTGTCTCCTCCTTGACACTGACTG
GGGGCCCCGATGGCTCTCCCCATCCTGATCCCTCCGCTGGTGCCAAGCCCTGTGGCTCCA
GCAGTGCTGGAAAGATCCCCTGCCGCTCCATCCGGGATATCCTAGCCCAAGTGAAGCCTC
TGGGGCCCCAGCTAGCTGACCCTGAAGTTTTCCTACCCCAAGGAGAGTTACTCGACAGTC
CATAA
gtcaactgttgtgtgtgtgcatgccttgggcacaaacaagcacatacactatatcccata
tgggagaaggccagtgcccaggcatagggttagctcagtttccctccttcccaaaagagt
ggttctgctttctctactaccctaaggttgcagactctctcttatcaccccttcctcctt

Predicted peptide sequence(s):


>CDSN_1|GENSCAN_predicted_peptide_1|569_aa
MPSPEAPRSDSDSCPGNVQLWHKGPRCPRAAISQEAVQPEMGSSRAPWMGRVGGHGMMAL
LLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISS
ARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSH
SGSSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQ
TSGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQH
GSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYP
VGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLC
GGGSTGSKGPCSPSSSRVPSSSSISSSSGSPYHPCGSASQSPCSPPGTGSFSSSSSSQSS
GKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIR
DILAQVKPLGPQLADPEVFLPQGELLDSP