GENSCAN 1.0	Date run: 16-Jan-104	Time: 16:09:36

Sequence CDC5L_1 : 61877 bp : 38.70% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1460   1504   45  1  0   96  107    20 0.008   5.45
ccacccaatatctcgcgagacttgctattctgcgccccctcccaccttgcgcttgcgcag
atcttcaaagcagaaggtcgcgcttggaggaagtggcggctttgagtccggtggcccaat
cgctgttactacttctctgaagctcctctcggctgcttgccgagacaccctgccgccaag
ATGCCTCGAATTATGATCAAGGGGGGCGTATGGAGGAATACCGAG
gtaagtctccttttcccgccgtccgctgcccgccgctccctctagcagcttgtgcgcacg
cgcgcggaggtcgggggggcgacgaggagaccctgtggggtctgcgtggagggcagcccg
ggggctgacccttggggccctttccgtgtgtctggccccgtgttgtgcgagcgccagtag

 1.02 Intr +   3904   4007  104  0  2   67   80    81 0.220   3.25
attcttggttgctgttattatagttaatgaggttttcatccttagtcttttaacctaggt
ggtgtgtatgtgcatgttatatgtctctttctccaatagccctatcagagttaatttaaa
ttttgtcttttcccacttggagttttgtgactgaatgtactctttggcaattttttttag
GATGAAATTCTGAAAGCAGCGGTAATGAAATATGGGAAAAATCAGTGGTCTAGGATTGCC
TCATTGCTGCATAGAAAATCAGCAAAGCAGTGCAAAGCCAGATG
gtatgtatcagtttaataagtggaaaacagaaaaggagcttaattatgatgatggaaaat
gtcaactctgtgaaccttatcaaagaaagcagacattgtaatataacaaggcatggagtg
ggagatggaagttgggtgtttgacttagctgtcacttgcttcctgtgtggtcttaggcaa

 1.03 Intr +   6303   6464  162  0  0   61   84   153 0.886  10.37
aatgtgatgagatggggaatattgactggggtaagtgtaaccacacagcaaatattctgt
tgtcaaaaagaacagtttttgtaattgaaggatgagagcacaagtcagtgtatccattgt
gcaaattggatatttatgccaggtaactgattaatatataaaatgatctatgtttaatag
GTATGAATGGCTGGATCCAAGCATTAAGAAGACAGAATGGTCCAGAGAAGAAGAGGAAAA
ACTCTTGCACTTGGCCAAGTTGATGCCAACTCAGTGGAGGACCATTGCTCCAATCATTGG
AAGAACAGCGGCCCAGTGCTTAGAACACTATGAATTTCTTCT
gtaagtgagtcttcagaaagagcatagaatatatgtatatgttctgaaagaggctgaata
aactttgagtattttctgtctttaaacttttaattatggatgtgagtaaacccaaagcta
aagccattggataatattttccatatctcagatggttgatcaaaattatgccttctgtca

 1.04 Intr +   7082   7209  128  2  2   88  110   242 0.995  25.80
gaaatcagcaaattttaatatcatttctttcagatgaagtgatagtaaaaaggctttatg
ttgttaaagcccatccattggtttttttggggggaaaaatatcgtcagaacttggaaatc
tggtaattttaactctaaatggtactgtagtgtgactaactcctatgggcttttttctag
GGATAAAGCTGCCCAAAGAGACAATGAAGAGGAAACAACAGATGATCCACGAAAACTTAA
ACCTGGAGAAATAGATCCAAATCCAGAAACAAAACCAGCGCGGCCTGATCCAATTGATAT
GGATGAGG
gtaagtgtatgctttgaggaatttatttctttggtaactgtaaactccttgggcctcact
cttttagttcctttctgaactcctctactttagaatcccttttttttttgagacaaggtc
ttgctctgttacccaggctggaatgaagtggcacaatcatggttcactgcggttttgacc

 1.05 Intr +   9977  10076  100  0  1   88   95    88 0.999   7.75
gtttttaacctaggttctttgacttcaaaactcaagctgtttccattatgctacaccata
aaatcagtatttttatgtttttttctcattttgagcaatagagtgtctcttacatacctt
gcttctagagtatgtaagaactaagaaaatacttagtttttcttcttttaatttttgcag
ATGAACTTGAGATGCTTTCTGAAGCCAGAGCCCGCTTGGCTAATACTCAGGGAAAGAAGG
CCAAGAGGAAAGCAAGAGAGAAACAATTGGAAGAAGCAAG
gtatgtgtggatataggaataaaaagcaaagtgtttttctcacataacaatcaacacaga
atacttctgtgaccagatatgtggtttttttttttttttcccctctccaccagcaatcag
gcaatcaattctgcagtggatagctgggtgtcctctaattcagttaactctaatactgtc

 1.06 Intr +  17445  17663  219  0  0   76   97   237 0.975  19.90
tgtatgtgtgtgtgcacctttaaattaaaactaggatttgttttggtgaatggtgtgagg
taaggatttaaataactatttcttccccaaataaatagatactttttttttaactgtatg
ggataatttatccctgtcacatggcatatgattttcaaagtgattttgcattcttttcag
ACGTCTTGCTGCCCTCCAAAAAAGAAGAGAACTTCGAGCAGCTGGCATAGAAATTCAGAA
GAAAAGAAAAAGGAAGAGAGGAGTTGATTATAATGCCGAAATCCCATTTGAAAAAAAGCC
TGCCCTTGGTTTTTATGATACTTCTGAGGAAAACTACCAAGCTCTTGACGCAGATTTCAG
GAAATTAAGACAACAGGATCTTGATGGGGAGCTAAGATC
gtaagttgcctttctgattttggaaatggaaaggaatagtaggaggagtcttacgaaggg
ccaagtattatccttgtcagagccagatttttattatttatttattttacattttttaaa
atcaattttttttttgagacagggtcttgctgtgttgcccaggctggagtacagtggcac

 1.07 Intr +  19959  20103  145  0  1   57   89    55 0.995   1.86
ccacccaccttggcctcccaaagtgctgggattacaggcgtgagccattgcacctggcct
tttcagttattttcttagaaatgaggttgtttgttcaaagggtttgagtatttgtatgga
ttttaatgtttttggctatatgtaacttaaaaatctcttttctactttgatccatgacag
TGAAAAAGAAGGAAGAGATAGAAAAAAAGACAAACAGCATTTGAAAAGGAAAAAAGAATC
TGATTTACCATCAGCTATTCTTCAAACTAGTGGTGTTTCTGAATTTACTAAAAAGAGAAG
CAAACTAGTACTTCCTGCCCCTCAG
gtaatctgataaaagcaaatttttcactatgtgaatttatatgcttatatcatttattca
gcaaatgtttgaaggcctgtgtaccaggtttgtgctggatgctcttaagaaattcacagt
ttaatgggtgagacacacataaaaacaagtaattgtgggctggctgtggtggcccacacc

 1.08 Intr +  22080  22268  189  2  0   82   97   259 0.981  25.06
ttggtttttttttttttttcaatagagacagttttgctgtgttgcccaggtaggtcccga
actcctgggctcaaacagtttgccctcctcggcctcccagagtgttgggattacaagtgt
gagccactgtgcccggcctcagttaaaatgttgcttactatgataattgtgtccttttag
ATTTCAGATGCAGAACTCCAGGAAGTTGTAAAAGTAGGCCAAGCGAGTGAAATTGCACGT
CAAACTGCCGAGGAATCTGGCATAACAAATTCTGCTTCCAGTACACTTTTGTCTGAGTAC
AATGTCACCAACAACAGCGTTGCTCTTAGAACACCACGAACACCAGCTTCCCAGGACAGA
ATTCTGCAG
gtaacgtgtcacgtagtagaatgaggcttttactttgtttattgtccttagaagtatcat
gcaggagaactaagcggtttggttgtgtttcttttagtgtaaatggtttgaaactgagtc
ctgaatgcatagatcttgcaatatttctgtagtagagaagctaaatagattcagcaatca

 1.09 Intr +  33085  33233  149  0  2   93   72   178 0.959  14.81
tgatagaaggaatggaaacattgaaatctgccatgactggtattcattttctctgttagc
tttcattgagaaaatgagtaaggattctgcctgcttcaagattggtatagtaggaccaga
agagattctgcaagtctgtctaaacttttaaacttgcttctttgtcttcttgttaatcag
GAAGCCCAGAACCTCATGGCCCTCACCAATGTGGACACCCCATTGAAAGGTGGACTTAAT
ACCCCATTGCATGAGAGTGACTTCTCAGGTGTAACTCCACAGCGACAAGTTGTACAGACT
CCAAACACAGTTCTCTCTACTCCATTCAG
gtattgtaaatgaacacgtttttattttagaaaaacttgaattcaaggacttagcatatt
tgctttagtaatgtttacggagaatgactacttattgtgttggattttcctctttgattt
cttcttcatagtaataaataatagtgtccaggaaatggttaaatactgtggagtgcctcc

 1.10 Intr +  36283  36445  163  1  1  108   54   160 0.997  13.66
agctagaccaaacattgattttaacctagagatcctaacaaaaccagctggacagaattt
tgaaatctttattcttttttttttctatatttcctgtgaaataatttatgtgaaaaacat
ttgaaagcacaatccaaatgtaagtggcacttctgttaattgggattcctgtctttctag
GACTCCTTCTAATGGAGCTGAAGGGCTGACTCCCCGGAGTGGAACAACTCCCAAACCAGT
TATTAACTCTACTCCGGGTAGAACTCCTCTTCGAGACAAGTTAAACATTAATCCCGAGGA
TGGAATGGCAGACTATAGTGATCCCTCTTACGTGAAGCAGATG
gtaaatgtcaattcccttttaatactcttaaatttttttttaatatctcatggatgccaa
attaaaatttctcctgttagtgcatatcacatataccttaagaatctatacacctgtgga
tgccagaaaaagaattatttgtaagacttgatgaaagggaatattttgggctcaaaaccc

 1.11 Intr +  38055  38219  165  2  0   59   94   286 0.762  25.54
catcccctcaagcatttaacctttgtgtttgaaaccatccaattattcttagttatttta
aaatgtacagttattttgactagagtcaccctgttgtgctatcaatttttaagagactca
taaaatactggtggaatgtttaatatgcatgaattgagaaggaccacttcttttctacag
GAAAGAGAATCCCGAGAACATCTCCGTTTAGGGTTGTTGGGCCTTCCTGCCCCTAAGAAT
GATTTTGAAATTGTTCTACCAGAAAATGCCGAGAAGGAGCTGGAAGAACGTGAAATAGAT
GATACTTACATTGAAGATGCTGCTGATGTGGATGCTCGAAAGCAG
gtgggtaactgtactgaaagaagcgtgagtttggctgaatgtgtcagtaggctggaagaa
tgaagaatagccattaaatgtcccaagatctctacctagtcctttttaatattgaaaaaa
cttctaaagtaaataacttatgtcattaataatgtatcctcacataattaacatactcac

 1.12 Intr +  39739  39819   81  0  0   25  100   157 0.998   9.52
gagagtgaatagactgattcatttctgttgccttagcattgcctttctacaaacttaaac
cgatttctaaactttagctattgaacacacatgatcttacataccaaagtgtttttagct
ttactgagagatatcaaatacgctatagctgcaataaaggatataaaaatcattttttag
GCCATACGAGATGCAGAGCGTGTAAAGGAAATGAAACGAATGCATAAAGCTGTCCAGAAA
GATCTGCCAAGACCATCAGAA
gtaagtgttagaatttctggtttaggaagttttaagtttctttttatatgattgctgcgt
tttacatcattcataaagactataaaacaaaatttcatctactttctggaatatagcaaa
gtagttctcaaatccaatctttaaaatgtttcagtagtaccagaaagaatttagaaggaa

 1.13 Intr +  40118  40360  243  1  0   63   86   184 0.998  12.47
aagtagttctcaaatccaatctttaaaatgtttcagtagtaccagaaagaatttagaagg
aaaaaaatggaaattgcttttgaaaatgtaaaaccgctgtttaattcatgctgtaacagg
taataacattaatatattatagtgatatgtttggtaattgtatttgttttaaaattttag
GTAAATGAAACTATTCTAAGACCCTTAAATGTAGAACCGCCTTTAACAGATTTACAGAAA
AGTGAAGAACTAATCAAAAAAGAAATGATCACAATGCTTCATTATGACCTTCTACATCAC
CCTTATGAACCATCTGGAAATAAAAAAGGCAAAACTGTAGGGTTTGGTACCAATAATTCA
GAGCACATTACCTATCTGGAACATAATCCTTATGAAAAGTTCTCCAAAGAAGAGCTGAAA
AAG
gtatgattgagctggaatatttcttcttgagatttaggtagttgttaggtgctgtgtatc
atggacaaataatgaacttatttttccctgttggtattcataaacaactgaaatgtatga
ttaggagatgcatgtttagattaagtgttatgaaaaggacatgctttaaatacctccatc

 1.14 Intr +  43349  43546  198  1  0   52   73   169 0.948  10.43
ttgactcaaaggcttcttaagctatttttcctaggtattgttatccacccttccaaaaaa
caaccaaccacatcttggatttgactcaaggcatgagggaaaaaattagtcttctaaagc
tctctggatatggcaagtgtttgtagtacttaaacttattgaaattattattgtaaacag
GCCCAGGATGTTTTGGTGCAGGAGATGGAAGTGGTTAAACAAGGAATGAGCCATGGAGAG
CTCTCAAGTGAAGCTTATAACCAGGTGTGGGAAGAATGCTACAGTCAAGTTTTATATCTT
CCTGGGCAGAGCCGCTACACACGGGCCAATCTGGCTAGTAAAAAGGACAGAATTGAATCA
CTTGAAAAGAGGCTCGAG
gttggtatccttttaaaattttaattttaaatgtactttgattgagataatgaactaaat
aatgccactggagacaatgtcagaaaaacacacctgaggtgcttattgcctttttagttg
ttggagaaaactacacttaagtgttggatcttcttggccttgttcattgtttttttttgt

 1.15 Intr +  59291  59503  213  1  0  117   82   187 0.959  18.99
tttaggtgcaagataaatccttcttaagcttgatattttgttacagtaattgagctataa
ggagttctagtgtatttttgctttgagacacatacatgaacgcatggtacctttttagcc
ctgttatttaatagcctgcttttctcatgtatgctgatgtgatcttcccctgctctccag
ATAAACAGGGGTCACATGACGACAGAAGCCAAGAGGGCTGCAAAGATGGAAAAGAAGATG
AAAATTTTGCTTGGGGGTTACCAGTCTCGTGCTATGGGGCTCATGAAACAGTTGAATGAC
TTATGGGACCAAATTGAACAGGCTCACTTGGAGTTACGCACTTTTGAAGAACTCAAGAAA
CATGAAGATTCTGCTATTCCCCGGAGGCTAGAG
gtaacgttatatattgaactgttgtttaaaaagagtgctgcaaagaattatcagggctgt
cctcttttacttctcctatgtagactgtctctgaagttggtactgtcaggcttttaaaaa
tgagagcctaaagtgtttgactttctaatctagaattgcctctgtgtagatggatagacc

 1.16 Term +  60243  60347  105  2  0   79   45   165 0.999   8.73
aagaatggctgtgatactggttttatagcaaaagtatttgatatgtttgtttctctttga
gaaatatttaactcttaagaatcatgatttaactcagctggtttttaagataataaagta
ctgtagatttttttcagtatagttacatctaaaataattacttaattttttttctttaag
TGTCTAAAAGAAGACGTTCAGCGACAACAAGAAAGAGAAAAGGAACTTCAACATAGATAT
GCTGATTTGCTGCTGGAGAAAGAGACTTTAAAGTCAAAATTCTGA
agtacagtttatattctgtcacaggattaattaattgccggttttcatactctagaaggc
tgaaactgatgtttatcttcattgacaaatttacccaccatctgtggtttttcagttgtt
tattttaaatgatatcgatcttacacattctgtgtataaagaccttaactccacaggacg

Predicted peptide sequence(s):


>CDC5L_1|GENSCAN_predicted_peptide_1|802_aa
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKRKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQD
RILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGA
EGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGL
LGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKA
VQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNSEHITYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKSKF