GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:06:01

Sequence CAP2_1 : 165150 bp : 42.31% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.04 PlyA -    303    298    6                               1.05
 1.03 Term -   1147    692  456  1  0  134   42   387 0.742  32.84
 1.02 Intr -   2007   1865  143  1  2   47  -19   133 0.010  -2.35
 1.01 Init -  22124  21992  133  2  1   78   63    89 0.784   5.75
 1.00 Prom -  22248  22209   40                              -3.65

 2.01 Init +  29074  29185  112  0  1  108   91   177 0.875  20.42
ctgagattaaaaagcaacaataatacatacaatttcatggttaaaaaataaaaataaagc
catccccagtgattgtgtcttcctcctcgctgttgttgagactgatggtgttggtttact
catcctccctgatgctcacgcagcctccatttgtgcctgtgcttttctagaatggccaac
ATGCAGGGACTGGTGGAAAGACTGGAACGAGCTGTCAGCCGCCTGGAGTCGCTGTCTGCA
GAGTCCCACAGGCCCCCTGGGAACTGCGGGGAAGTCAATGGTGTCATTGCAG
gtagggtcacaaactgttgtcattcctggtcttcttgtgggttacttcattttgtttcca
taatttcactctcaaggaacatttctattatccttcagcttccctactccttccatcgta
tgtgaccataacattaaccagaggcaagcaatccctgaaaaagagaaaggaagaaaacct

 2.02 Intr +  30606  30749  144  1  0   56   30   114 0.738   1.73
ggtataaggatgtcccaaatactgcatgggctatactgcgtgttatgcacctacagcaaa
catttattcattgcttctctgaaattcaaattgaaccaggcaatctgcatttaatatggc
aactctgttcttgtcacatgggcacttcctccttatctgacccatactgaatcctgtcag
GTTTTTTTGGGCTGAGAAAAGCCGTGGGGAAGAAGGGACTTCAGAAAAAGCTTTCACCAG
GAAAGACCTACATTGGTGCTTCTAGAATTTCAGGCGAATTTGGACCCGTGCCTGTATTAC
ATACCATGGGACAAAAATTACTGT
gtgagcacaaatgtgctggctggtttatttcccccctgaacataatgaaaattaaaatgc
tttgaatgaattgaaagggggtgttgttttaaggaaggctgccaggagcctgtaagtttt
tttccgcaccaactgagacacatctatgatttcattttaagcctctttttgttaactgta

 2.03 Intr +  34099  34199  101  2  2   59  103   126 0.948  10.11
atttttagtagagacgggtttcaccatgttgtccaggctggtcttaaactcctgacctca
ggtgatctgcctgcctcggactcccaaagtgctaggattacaggtgtgagccaccgtgcc
cggctagtcccaggttttcattcaacggccagggaataacaaactgctcctttccccaag
GTGTGGCACCCTCCGTGGAAGCCTTTGACAAGCTGATGGACAGTATGGTGGCCGAGTTTT
TAAAGAACAGTAGGATCCTTGCTGGGGACGTGGAGACCCAT
gtaagtactttcctcccctgttctcagtagagagtttaaacttaccagcccagcctctga
caacgctaacagcctgaggagatctttatttatttatttagtttttactctggctaggca
gatggtggctaaaacattcatttacccatttattcatttaattgttcctgcaaggcctat

 2.04 Term +  44415  44483   69  2  0   59   39   145 0.512   3.66
tccaggagccaaggagcctgtggatgctgatgccatctatgtcaggggtccccatccctg
ttaggaaccaggctgcagagcaggaggtgagtggcaggcaggtgagcggccaaagcttca
tctgtacttagagccactccccatcccttgcattactacctgagctctgccttctgtcag
ATCAGTGGCGGCATTAGATTCTCAGAGGAGCATAAACCCTATGGTGAACTGCGCATTCGA
GGGATCTAG
gttttgtgctccttatgagaatctaatgccttatgatctgtcactgtctcccatcacccc
cagatgggactgtctagttacaggaaaataagctcagggctcccacagattctacattgt
ggtgagttgtataattatttcattatatattacaatataataatagaaataaagtgcaca

 3.03 PlyA -  45480  45475    6                               1.05
 3.02 Term -  47016  46919   98  1  2   74   47   104 0.559   2.05
 3.01 Init -  48540  48408  133  0  1   94   47    67 0.531   3.55
 3.00 Prom -  55543  55504   40                              -4.55

 4.01 Init +  63650  63781  132  1  0   54   42   104 0.109   2.59
agatttgctgctgctaacagttttgtagtggatggcctctgagctgttttgttaattcat
ctgctaatgaaaatggaatagaaacgaaagacagaatatatgaggtatcatttaggccag
tggttttgaaagtgcagtgtccagacttgaagcatcagcctcacctgagaacttgtagaa
ATGCGAATTCTCGGGCCAACCCAAATCTACCGAATCAGAAACTCCGGAGATGCGACTCAA
CAATCAGTTTTAAGAAAGCCTCCAGTTGATTCTGATGGACACACAGAACCACTGATTCAA
GCCTTCTGCGAG
gtgcataatatgtcaactcagatatctttcttattctgaaaagatacagaaacggggttg
gtgcttatgttcatgtttacaaaatcaagcatcttcagtcttgttttaagcaaaatcatg
aaatgggtgaaatttgtctttagcattctattacctctttttggggctcatttcttgtct

 4.02 Intr +  70505  70582   78  1  0  103   94    25 0.041   3.43
ggttgttcccatgttttggttattatatgatgctgttacgaacattcatttacaagtttt
tgtgtgaagatatattttcatttttcttgggtatatacctacgggtggaattgccagatt
atatggtaacaatttttaggagtcaaacattgaaactgccatcttcctctttgttcccag
GCAGAAATGGTGCACAGTGCTTTCCAGGCCCAGCGGGCTTTCCTTCTGATGGCCTCTCAG
TACCAACAACCCCACGAG
gtaagagagtgtcctgagagggaaggtgtcccagggtatgcgcagtgtaagatggaaaac
aaggaggcaacagaagcatttattatagtcgacctcctaaaaatgagacttacagcacgt
gtatgttctgtctctaatctggatcatggtatagaacaattcttctctctcctaatctca

 4.03 Intr +  73056  73146   91  2  1  103   47    54 0.734   1.45
tgataaaggggagggaaactggttcccagggaggcatgcactggaaacgtctggcagcac
ttaccacagtgctccatgtgcaataaggcctggaccaggaccaggaaaatgcagagcagg
cttatgatgcctacctcccttcctggcccttctctctacttccctttcctctttattcag
AACACCGTCCTACTACTTCCACCTGACAGAAAAGCAGACCTGAGTGATCACCACGTGTTG
TTCAGAACCCCTGTCCACTCCAGTGGGGATG
gtacaggctcaagaggctgaagaagagacccagaaccagcagaaaagacctgaagtttat
tggggacttgcatacaggggagagagtccagtagcagagggctggacaggagaactacaa
ccacttgcgaaaggcgtgtaatttatatagcattttcatgtaacatcctccctctaacaa

 4.04 Intr +  73926  74265  340  1  1   52   -6   207 0.041   1.31
gaattaactgctgtaatttcagctctcagtgacatacaacagtgattctccaactttagc
gtgcatgacagttccctggagggttgtcagaactcagactgctgggccccacttacagag
cttccaattcagtaggtcttggttgagtcccaagactctgcggttctaaaatgttcccag
GTGATGTGATACTCCTCGTCCAGAGACCACACTTTGGATCCTGTGCTGTATGGATGGCTC
TCACTGTTACAATTGAAGCTCAGATTTATTTCAGGTGCTTCAGAATTTCATTTCCAACGG
TCTCTAGACCACTGCTTCTCAAACTTCAGTATTCATTTGAATCATCTGGAGATCTTGTTA
AAGTGCAGAGTCTGATTCAGTTGGTCTCAAGTGGGGTGCAAGAGTCTGTAGTTCTAACAG
GCTCCCCGGCGATGCTGGTGCTGCTGATTTCTCACTACACATTGAGCAGCAAGACTTTAG
TCATTGCCATCCACAATCCCAACAAGCACAGAATCCCTTG
gtagtcaaatctcgaattcatattctcttctcctaccatttctgtagcaaagtaggccgt
gttatgctgcagtaacaaacatctctaaaatcttagtgatggacaactgcagaggtttat
ttcttgtgcgcactatatagctatctgttgcaagtcagcttagtatctagtagatgagtt

 4.05 Intr +  84179  84221   43  2  1   72   45    93 0.151   0.72
agatatgttcaaaatcattctgtaattctctaataccacgcttgagattggattatcttt
ttcagaagtaacaatcaaagaatcacagcattctgaggctgtacccaggagtgcactggg
gagggctcccttggcactggtcttttcattcaacttttctttgttctgccatctcccaag
GCTTAAATGGGAAAAGGAGAAAGACGAGAACAACGGGAAGTAT
gtgaggagagaggatagagaaagataatcctatccctgtggcttgtcagttagaatgagg
gagggagttgtgagctgatcatgtggctatgcaccttagaactttttcccacaatacttc
tctgaactgctttggtcttattttcttacttctttttttttttttttttttttttttgag

 4.06 Intr +  86497  86623  127  0  1   97   55    53 0.222   2.23
ttcccagtgccctgcttgcttcttaattgtcctcattccattcagcctccttgaagaatt
tttactgctgaccatcaccctcctcaaagtttttccttctcttgggtaataacactatgc
tttctgtctgttttacttcatttcttgctctgacttctcttcttccctctatcccttaag
TGTACATATTCCTTTAAGATTCATTCTATGTCATCAGAAGAGGACTTTCTCAAACCTGGT
CTCTCCCCTGTCAGTTTCATCCGTTCCCATGGTGGGGTCCGTCACTCATCTGCTGGTGGT
GCCCACT
gtacgtctccagctgaaggctcttgctccacggccctgggcatgggtgtcctccaggagc
tcaaatgcagtgcgtctgtaccacacacacacctgtacgtgtgtgtacacacacgtctgt
accacacacacctcctccaaatgctgggctccctcattctttctcccagttgatggaacc

 4.07 Intr +  90244  90359  116  2  2  105   86    42 0.594   4.95
aggccacgctccctcagatggcccaagggaagaatctcttctgagactccctcctgactt
cttgagggttgctggtaatctggtgtttcgtggcttgtaaatgcatcatactccgtcttt
atgttcacgtggtttctccctgtgtgtctgtctctgtgtctacatttcccctttccatag
GGACACCTAGTCGTACAGGACCAGGGGCCCTCCCTACTGCAGTACGACCTCATCTTAACC
AATTACATCTGCAACAACCCTATTTCCAAATAAGGTCACATTCTGAAGTACTTAGG
gtaaggacatcatcatatgaattagtggggggacaccactcagcccgtaacactagattt
gtcaggcattgttctattgttattatctgtgtaatgcaggcgtcatttgggccagttgtt
tagcgtgtcctggcttacgccatcacatattcctctgtaccaataactgcttcttctctc

 4.08 Intr +  94844  94957  114  1  0  136   94    21 0.728   7.22
tcgtgcctgctggaagccctgtcccttacctgcctttcggagccatctccttctcccatc
ccccttgctgtggacgtccccagtcgcttatcaagcccctgagaaacactcccaattggt
atctgctctgacttggtgctgtccccctttccctgcctctgactctctcctccctgacag
GTCAGTTATTCTAAACTTCCAACTAGGCCACTGCTCTGCATTAAATCCTCTCAGAGCTCC
CCAAGAGCAAATGCCTGTCTGGCTCAGCAGCCTCATCACCCAGAATGCCACCAG
gtgggtttgtttgtttgtttgtttgtttgtttgtttttgagatggagttttgctcttgtc
gcccaagctggagtgcagaggcaccatcttggctcactgcaacctccgcctcccgggttc
aagcgattctcctgcctcagcttcctgagtagctgggattacaggcacccgccaccacgc

 4.09 Term +  98194  98412  219  0  0    9   42   173 0.442   0.86
tttcaggctagaaaagaggattataaaacacttgcaattttaaaatggagtattgggttg
ggtggggtgtaagtcacaaagctagatgttcctgccatggcaacagcacgcctttgcggg
cagaggtcctgcccatgagttttcggttgtagtcctaagattctgcatgggtccaatcag
AACAAACAGAATGAGAGCCTTGGAGAAGGATCCTGGAGGCCTCCTATTAGGCCAGGATTG
CTGGAGTTTGGGGACTTTGAGAAGTCCTGGAAGAGAGACTGGGGCAGCCAGGGCAGCAGG
GGGTACCCAAAGGGCTTGGAAAGTGGCTGTTTGCCAACCACTATAAAGGATCATGGCGCC
TTAACAGCTGGTGAAGCTGCCCTTGTGCCCTTTGGCTGA
atgtcagctataagctcagccctcctgctgacatgtctgtttcccgtgcaagtaaactct
tcaggctgtgcccatagctccactgggtaaaccacaggacgtgtgctactaaaagaaatc
tgtttctctttcattcttcttctgccttgagccggtagaaactcagtgtcattaacatca

 5.01 Init + 101221 101481  261  0  0   65   71   139 0.033   7.01
caggagagaaacaatacagagctcacccctggctgattgagggccagaagcgccattctt
gtaggtgaggaacagagcatgtatacactgtgttgttctgaattggaactgaattgtact
gaatacaggaacatatagcacatttatgaatcatgtgtactggattgaaaatgtgagaag
ATGCTCCCAAGCAAAGACACACTGAGGAGTGGAGACCAGAAAGGAACTGAGCTGAGGAGG
GGGCAAAAAAAAAAAAAAAGCAAGCCCATTGCAGCTGCACTGCAGATATTACTCATCAGT
TGTGGCCCCTGGGAACACCTGGTTGAGGGCAGCCGAAACAGTACGTCTAAATCGGAATTC
CTGGTCTTTGCGCTAAAGCCTGCTCCTTCTGCCATTTCCCCCATCTCAGTTGATGGCGAC
TCCATCCTTCTAGTTGTTCAG
gtcagagaccaaggagtcattcctgactcctcatttgctttgataccccacatccggtct
aaaatctacttttcacaatctccactacattcactctggcctgagctgccttcatctctt
gtcggaattattgcagtagtctcgaatacgatgtccctagttctgcgtttaccctccaat

 5.02 Intr + 114678 114821  144  2  0   61   89   234 0.193  20.36
agcacggcattaccataaccaagaacaaatgcatgctgttctcaaagatgattatatgtt
tcttttagaccccttaacagacggcaggtcctgaattctcctgcttaggccaacatggat
agaggtgctatgcgtctgctctgtctgtagtaaaagcccccgatgtttgactgcttacag
AATGACGTGGCCGCACTTCTGAAACCCATATCGGAAAAGATTCAGGAAATCCAAACTTTC
AGAGAGAGAAACCGGGGGAGTAACATGTTTAATCATCTTTCGGCCGTCAGCGAAAGCATC
CCTGCCCTTGGATGGATAGCTGTG
gtgagtccaggtgcaatgttgcctcttcacctcatcacacgtttggagtatttaggagaa
ctagtagcttagctaccttcacgctccttgcactgaaggaagcttcttcctgggctgaat
gcatccactttctcctaccctgtttaaagttcaagctttctgttctgagatactgtagaa

 5.03 Intr + 115150 115235   86  0  2   46   98    64 0.195   0.90
gttcaagctttctgttctgagatactgtagaaagtgtttttatcaacctttacagagcaa
catgtgcctcccactttcaagtccacgcgtctccattgcttttcttcttctttaaggcat
tttctttcttatcctatttttttttccttctatgcttgggtgacggtcctgttttctcag
TCTCCCAAACCTGGTCCTTATGTCAAGGAGATGAATGACGCTGCCACCTTTTACACTAAC
AGGGTCTTAAAGGACTACAAACACAG
gtacgtaccttcctttactcaccaaattttcagttgattacttgttagacatttgtccct
aaaactcagtccagttaactactgattcctttccaaggctctacactaatgtactataaa
ctttaaaggaaaatctaatctttgcagataaagtcaagtggaaagtggaatcaattatcc

 5.04 Intr + 139292 139506  215  2  2  103   63    93 0.003   5.74
caggaaccttcttcttctcttctacaccttccatggttccagccagaaaaagagtggtct
ctgcttgttaaaaatgggtaagaacactaataggttgtctgacctgtacttaaagttgga
gatcaatgtcgtctatatacattccccccatgcttaaagcccttcagcttctccttttag
GATAAAGATACCTGCAAATCACCCAGACCGTCCTGAGGAGAGCTGGTCACTTCCACCTTT
GCACCCCAGCATCCCTCATGCATGTGATGTGTGGTTCATATCACACTTCATCTACAATTA
CTTCTTTGTGCATTTGTCACCTCCACTAGATTATGAGCTTCTTAAAAAACAGAACGTATG
CCTGTTTCCTCATCAAGTACCCCATTCCCAGCAAG
gtagcccttggtaaatgtttgtttagtagactgacaaagcagccttagttattcaattca
cttttaatccaactattaagagttagattctactcaaaccaaattctctactacctctat
tgttgggtttgaaaatctttttttttttttttttttttttggaggcagagtctcactcta

 5.05 Intr + 141875 141988  114  0  0   60   84    42 0.006   0.50
taaaatgaaactaactgttaggataaaacatactataaaagaatttgttattaagaaaag
ccttcttttgagaaggaccagaaatattctgataatttacaagtaaacatctcttatttg
gtgtctttgttgaattctccatgtgcagatccaaccatatagcttgtgttcattctgcag
AGGCACGAATGCAGTCTGCAGGCTATGGCTGCAGTTTCTCAAGACTGTCACTGGTAAATG
GTAGGGAAGAGAACCCTGTCATGTCTTACCCATCTCAGTCAGGTTCCTGGGCAG
gtactgttagttcagaggctcttcctagccctcgttcttggcaccgcctacacaaggttt
gcccatctgggagcgatccttttgtatctctagactgatctaactcagattgtaaaggat
acaaaatctgccctccgcccgtgccccctctcctgtgggctctgctgtcccacagagcct

 5.06 Intr + 146866 146967  102  2  0  139  100   103 0.633  15.83
ctcattggcagcaggtttcgactctctcgggcaaaatcccagcaagggcgcagtctcaat
gcaatgcaatgccctgtcttctgtcttctcagggtcctgtagcatccacagtatcagcgt
tttctgtcctctcctctgggcctggccttcctccaccccctcctcctctgcctcctccag
GGCCACCTCCACTTTTCGAGAATGAAGGCAAAAAAGAGGAATCTTCTCCTTCACGCTCAG
CTTTATTTGCCCAACTTAACCAGGGAGAAGCAATTACAAAAG
gtgagagagaaaagaagaccttgaagctgcctccctttccctctggctcccagacacaaa
agagccgctggagccccagtgatggatacatcactccatccctgcctccagcatgcaggg
agagggggaactggtgctgggaagacaggagcctgccatgttccttatgtccatgcagac

 5.07 Intr + 148482 148657  176  1  2  110  103    59 0.990   8.34
caactctcaacttgtacaggactcagctcctgcatcctgacttggagaaagcactagact
gttttgaaagtggccttaccaaaagttcttgtgctctttatttacatcatgttgatctag
caagttagagacatttccctttgcataaaataaatgtgtccatgtgtgttgtcctcctag
GGCTCCGCCATGTCACAGATGACCAGAAGACATACAAAAATCCCAGCCTGCGGGCTCAAG
GAGGGCAAACTCAATCTCCCACCAAAAGTCACACTCCAAGTCCCACATCTCCTAAATCTT
ATCCTTCTCAAAAACATGCCCCAGTGTTGGAGTTGGAAGGAAAGAAATGGAGAGTG
gtaagtgaagcattttaacctttattttcctgacatgcgccaatgaaaggaccaacagcc
aaaccatttaccaagatctgaaggatttcttttttttaatttttgtattggtacataaca
tttgtatatatttatggggtacctgtgatattttgttacatgcgtagaatgtgtaatgat

 5.08 Intr + 150346 150469  124  0  1   83   50    71 0.921   2.04
ttccgtttttcccatcctaacaatgacagagtaagacctgtggtttcatctataaggaga
tggttccaaaagaatatattgcaaagccatacttcatgctgagctcgtactaatttcagt
gtgcagtggtttctgtttatatatgctgatgtttaatatttgtatttgtcttaattctag
GAGTACCAAGAGGACAGGAATGACCTTGTGATTTCAGAGACTGAGCTGAAACAAGTGGCT
TACATTTTCAAATGCGAAAAATCAACTATTCAGATAAAAGGGAAAGTAAACTCCATTATA
ATTG
gtagggcagaattatggctctatggttattatgatgttttataaacaagctgtatgtatt
tagtggagttggttttttgttgtgttttttctccccacagacaactgtaaaaaactcggc
ctggtgtttgacaatgtggtgggcattgtggaagtgatcaactcccaggacattcaaatc

 5.09 Intr + 150570 150652   83  1  2  110  115    42 0.067   7.54
gctgaaacaagtggcttacattttcaaatgcgaaaaatcaactattcagataaaagggaa
agtaaactccattataattggtagggcagaattatggctctatggttattatgatgtttt
ataaacaagctgtatgtatttagtggagttggttttttgttgtgttttttctccccacag
ACAACTGTAAAAAACTCGGCCTGGTGTTTGACAATGTGGTGGGCATTGTGGAAGTGATCA
ACTCCCAGGACATTCAAATCCAG
gtaagcagagcctttccaaccatgctgtaataagcagagcctttccaaccacgctgtaat
aagcagagcctttccaaccacgctgtagtaagcagcctttccaaccacgctgtaataagc
agcctttccaaccacactgtaagctgcggccttgcacagaccatccactctgcctccaag

 5.10 Intr + 158973 159113  141  2  0   83   92    52 0.038   4.73
cacctatcctattctgcctgaagactttgccattaactcacctccccagctttgacccag
tgaattctaatgcttggttaagcccaagctaaagccaagaggaattgagattgtatttat
tcgagggcattgttatttctgtttctttgctttggtcccaggtattttttcctatttcag
GTAATGGGGAGAGTGCCAACAATTTCCATTAATAAGACAGAAGGTTGCCACATATACCTC
AGTGAAGATGCATTAGACTGTGAGATCGTGAGCGCCAAGTCATCTGAAATGAACATACTT
ATCCCTCAGGATGGTGATTAT
gtaagtacctttcaaaaggctgtcaagaatttttctggagccttcattattaacattctt
agagattgattaatcagctaccaacctgcgagctttatttgtagcataattcacaggcag
gcgaggaattcagggagctgtcttccacatctcttcccgcctattagcttcttgactgta

 5.11 Term + 163868 163951   84  1  0  105   32    59 0.021  -1.33
atgacatacacaagtctccacgtgacaaagacctccccatgacgcagcttgcaattcgat
cgaatttctttgcctatcatgtggcacaaatcagcctcaccatctgtttgcaaaaggaag
ccttagtttaaataactttgttgtagtttaaataactttgttgttcttgcctttttccag
AGAGAATTTCCCATTCCTGAACAGTTCAAGACAGCATGGGATGGATCCAAGTTAATCACT
GAACCTGCAGAAATTATGGCCTAA
cttcctgagagaccgaaccccctcacctgaatccccctctatcaaacaaacaaaaaagca
gcagtaaagagctagaagttgcagtagcccctactgctttagctttggcctccaacgatt
ctgtgctatagatacagcactgtttctggcacgcctcgtgggcattttgaaatatttaac

Predicted peptide sequence(s):


>CAP2_1|GENSCAN_predicted_peptide_1|243_aa
MEYYAAVKRNEIMSFAGTWKKLEAIILSKLTQEQKTKYPMFSLIECIHSNIATTCSEHHS
DENKEKAICRLIFGPKSDDTAATSTNTPLPKALNRSRCQSRCSRGESPAASGAPNTDELR
GERESKATRVGSGNKGEQRGEGGGGKEGQMGRGRKDREMGKAEPGNASLPAKRQAMREMD
SVHEAVLQRSLERSGGSWLKEAQIGWIPEDLCREMGNGSLGIKRRHVCPQTQYEDKGSGR
RRS

>CAP2_1|GENSCAN_predicted_peptide_2|141_aa
MQGLVERLERAVSRLESLSAESHRPPGNCGEVNGVIAGFFGLRKAVGKKGLQKKLSPGKT
YIGASRISGEFGPVPVLHTMGQKLLCVAPSVEAFDKLMDSMVAEFLKNSRILAGDVETHI
SGGIRFSEEHKPYGELRIRGI

>CAP2_1|GENSCAN_predicted_peptide_3|76_aa
MEYYAAIKKDEFMSFVATRMKLETIILSKLLQGQKTKHCMFSLIEKLFSRKSVPGAKKVD
YCCSKSSVTKAVGTET

>CAP2_1|GENSCAN_predicted_peptide_4|419_aa
MRILGPTQIYRIRNSGDATQQSVLRKPPVDSDGHTEPLIQAFCEAEMVHSAFQAQRAFLL
MASQYQQPHENTVLLLPPDRKADLSDHHVLFRTPVHSSGDGDVILLVQRPHFGSCAVWMA
LTVTIEAQIYFRCFRISFPTVSRPLLLKLQYSFESSGDLVKVQSLIQLVSSGVQESVVLT
GSPAMLVLLISHYTLSSKTLVIAIHNPNKHRIPWLKWEKEKDENNGKYCTYSFKIHSMSS
EEDFLKPGLSPVSFIRSHGGVRHSSAGGAHWTPSRTGPGALPTAVRPHLNQLHLQQPYFQ
IRSHSEVLRVSYSKLPTRPLLCIKSSQSSPRANACLAQQPHHPECHQNKQNESLGEGSWR
PPIRPGLLEFGDFEKSWKRDWGSQGSRGYPKGLESGCLPTTIKDHGALTAGEAALVPFG

>CAP2_1|GENSCAN_predicted_peptide_5|509_aa
MLPSKDTLRSGDQKGTELRRGQKKKKSKPIAAALQILLISCGPWEHLVEGSRNSTSKSEF
LVFALKPAPSAISPISVDGDSILLVVQNDVAALLKPISEKIQEIQTFRERNRGSNMFNHL
SAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHRIKIPANHPDRPEESWS
LPPLHPSIPHACDVWFISHFIYNYFFVHLSPPLDYELLKKQNVCLFPHQVPHSQQEARMQ
SAGYGCSFSRLSLVNGREENPVMSYPSQSGSWAGPPPLFENEGKKEESSPSRSALFAQLN
QGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPTSPKSYPSQKHAPVLELE
GKKWRVEYQEDRNDLVISETELKQVAYIFKCEKSTIQIKGKVNSIIIDNCKKLGLVFDNV
VGIVEVINSQDIQIQVMGRVPTISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQDG
DYREFPIPEQFKTAWDGSKLITEPAEIMA