GENSCAN 1.0	Date run: 16-Jan-104	Time: 15:18:18

Sequence BTN2A1_1 : 14076 bp : 46.85% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1877   1958   82  1  1   48   91    94 0.856   4.83
ccctctctcgggacatacctgagccttcggatgcaggggactccctgaagttggggcact
gatgagacctacttgagtgacgggagaggttgggcccgaccagcactgaggtgccaagac
tcctaggctgattctcctctgtaaccctaggcctcctgtccctgcctgctctgggtgctc
ATGGAATCAGCTGCTGCCCTGCACTTCTCCCGGCCAGCCTCCCTCCTCCTCCTCCTCCTC
AGCCTGTGTGCACTGGTCTCAG
gtagggatgtgtgccacttgctgctgtcacctatcagaaaggaacatcaaccctgtagtc
tgcaaagggaaagaaagaaggactgtggagttgttgacttaccctttcattctgaacatg
ttcattgaatttataccagcactgtccaaaaggaatacagtgaggcacaaaggccgagtg

 1.02 Intr +   2721   3068  348  1  0   84   96   404 0.978  36.13
agttactgctcccaggggtgctgtcgactagccacagctactggtccccagatttctcag
cccaaagagaccctatggccatggaaaaaataagtttgtccctagaatatctgcttcctt
tcttgccttagagatgtgatggctggtgtctttgtctgactctacccctttgttgaacag
CCCAGTTTATTGTCGTGGGGCCCACTGATCCCATCTTGGCCACGGTTGGAGAAAACACTA
CGTTACGCTGCCATCTGTCACCCGAGAAAAATGCTGAGGACATGGAGGTGCGGTGGTTCC
GGTCTCAGTTCTCCCCCGCAGTGTTTGTGTATAAAGGTGGCAGAGAGAGAACAGAGGAGC
AGATGGAGGAGTACCGAGGAAGAACCACCTTTGTGAGCAAAGACATCAGCAGGGGCAGCG
TGGCCCTGGTCATACACAACATCACAGCCCAGGAAAACGGCACCTACCGCTGTTACTTCC
AAGAAGGCAGGTCCTACGATGAGGCCATCCTGCACCTCGTAGTGGCAG
gtgcgtcgcttcattttgctttgttactttggcacagtgtgactttggggaaagtttctc
tcctaacctcaggcccattgcagaccagcaaatttttgtctggactcccttttccactct
ccctgtggaaacggaattccagggaaaaatccttcctcctgcacaagggacacatgagtg

 1.03 Intr +   6484   6765  282  2  0  118   92   185 0.996  19.29
ttctccaacatcaatgttctttcttccttaccctcatcctttttttcttccttcctattt
cttgtttcctatctccctcttttttacctttactttctagcttcacagaagagatgcaat
aggcacagaagagatgcaaaaggcactgacttttgcctgaaccctgatatctctccacag
GACTAGGCTCTAAGCCCCTCATTTCAATGAGGGGCCATGAAGACGGGGGCATCCGGCTGG
AGTGCATATCTAGAGGGTGGTACCCAAAGCCCCTCACAGTGTGGAGGGACCCCTACGGTG
GGGTTGCGCCTGCCCTGAAAGAGGTCTCCATGCCTGATGCAGACGGCCTCTTCATGGTCA
CCACGGCTGTGATCATCAGAGACAAGTCTGTGAGGAACATGTCCTGCTCTATCAACAACA
CCCTGCTCGGCCAGAAGAAAGAAAGTGTCATTTTTATTCCAG
gttagttctctgccctctgagactcgtcgagtgcatgggggatcctcagcacacagatgg
agcccagaacggggatgggggcagcagtgtgggtgaaatagtcctgggccctaaggacct
ggaggctgcagctgagtgaagcctttccgcttctcacaaaaggagaatcaaagtgtccca

 1.04 Intr +   8458   8646  189  2  0   64   93   147 0.766  12.36
gccagcatcactttctccatctgagttttctgagggagaaagcaggagagcaggtggctg
aggagctcttcaagtgtgctcctaggggcactcttaccccagatgttctgtttcaaacta
agtggatatttctggctgccttttcagaatcctttatgcccagtgtgtctccctgtgcag
TGGCCCTGCCTATCATTGTGGTTATTCTGATGATACCCATTGCCGTATGCATCTATTGGA
TCAACAAACTCCAAAAGGAAAAAAAGATTCTGTCAGGGGAAAAGGAGTTTGAACGGGAAA
CAAGAGAAATTGCTCTAAAGGAACTGGAGAAAGAACGTGTGCAAAAAGAGGAAGAACTTC
AAGTAAAAG
gtaaaagaggctgagtatggtggctcatggcttgaatcccagcactgtgggaggctgagg
caggcagatcacttgagccctggagttcgagaccagcctgggcgataaagtgagaccctg
tttaattaaaaaaaaaaagaaaagaaaaagagtagaaggacagttcaccaccatagaaag

 1.05 Intr +   9193   9213   21  2  0  105   85    25 0.646   1.42
tgtgctggtactacccagccacctgatcatacataatttctggtttctgacagtgcccta
ggcatgagggaagggagatgttgctgttcatagaaaggacggttcctgcattgtttacta
aaaacccaacttcttttagttcttctgtcaaagacatgattttctttgtttgtttttcag
AGAAACTTCAAGAAGAATTGC
gtaagtttagcctttccttaactacatgtacaatttgagttctgctcagcaacatctcat
gacattcgtctctgtctgtcccttgcaggatggagaagaacattcttacatgctggtgag
tgcctctgatgttccctcagatctcagctttctccacactagccagctaacaggactcct

 1.06 Intr +   9302   9328   27  0  0  136  105   -15 0.799   3.09
attgtttactaaaaacccaacttcttttagttcttctgtcaaagacatgattttctttgt
ttgtttttcagagaaacttcaagaagaattgcgtaagtttagcctttccttaactacatg
tacaatttgagttctgctcagcaacatctcatgacattcgtctctgtctgtcccttgcag
GATGGAGAAGAACATTCTTACATGCTG
gtgagtgcctctgatgttccctcagatctcagctttctccacactagccagctaacagga
ctccttagaggagatgagcaaggggcccagggcaaggtggggacagcagggaacgggggt
cagttcatcaacagtgtcccagcaatgatgcatcatgtctcttctgtcagggaatcccag

 1.07 Term +  11188  11789  602  2  2   61   39   397 0.985  26.79
cagaagtgcagcttcagtaattctcagtgtgtgagctgcctaggatcagagagccttcat
ggaagtggccactacgtggggatcccttcagagatatctgagacctctctggggatcagg
aaccacacaatccccagggttcctgagaccccaggcctaaacctgagacttcctctgcag
TTGATGTGGTCCTGGATCCAGACACCGCTCATCCCGATCTCTTCCTGTCAGAGGACCGGA
GAAGTGTGAGAAGGTGCCCCTTCAGGCACCTAGGGGAGAGCGTGCCTGACAACCCAGAGA
GATTCGACAGTCAGCCTTGTGTCCTAGGCCGGGAGAGCTTCGCTTCAGGGAAACATTACT
GGGAGGTGGAGGTGGAAAACGTGATTGAGTGGACTGTGGGGGTCTGTAGAGACAGTGTTG
AGAGGAAAGGGGAGGTCCTGCTGATTCCTCAGAATGGCTTCTGGACCTTGGAGATGCATA
AAGGGCAATACCGGGCCGTGTCCTCCCCTGATAGGATTCTCCCTTTGAAGGAGTCCCTTT
GCCGGGTGGGCGTCTTCCTGGACTATGAAGCTGGAGATGTCTCCTTCTACAACATGAGGG
ACAGATCGCACATCTACACATGTCCCCGTTCAGCCTTTTCCGTGCCTGTGAGGCCCTTCT
TCAGGTTGGGGTGTGAGGACAGCCCCATCTTCATCTGCCCTGCACTCACAGGAGCCAATG
GGGTCACGGTGCCTGAAGAGGGCCTGACACTTCACAGAGTGGGGACCCACCAGAGCCTAT
AG
aatcaattccttggtctcacagccatgtagacaagccctggtcatctcagcagccaccgc
acaacacccctggtggaagacacgccctcctcccctctggtcacacaagagaacatcttc
cagctgcctctttcacacccactacagacctcagccccagttttctcctcctcactaggc

Predicted peptide sequence(s):


>BTN2A1_1|GENSCAN_predicted_peptide_1|516_aa
MESAAALHFSRPASLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLRCHLSPEKNAE
DMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQEN
GTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRD
PYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPVAL
PIIVVILMIPIAVCIYWINKLQKEKKILSGEKEFERETREIALKELEKERVQKEEELQVK
EKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRHLGESVPDNPERFDS
QPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIPQNGFWTLEMHKGQY
RAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFSVPVRPFFRLG
CEDSPIFICPALTGANGVTVPEEGLTLHRVGTHQSL