GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:18:52

Sequence TCOF1_1 : 45020 bp : 52.42% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1276   1383  108  0  0   72  115   150 0.998  14.29
tcgccttgaggggcggggccggccactcccggagaggggactacgtttcccggcgcgccg
cgcggccggagcgaaagaggagccggaagtgtggcgcgcgaggtctaagggcgcgaggga
agtggcgggcggggactaaggcggggcgtgcaggtagccggccggccgggggtcgcgggt
ATGGCCGAGGCCAGGAAGCGGCGGGAGCTACTTCCCCTGATCTACCACCATCTGCTGCGG
GCTGGCTATGTGCGTGCGGCGCGGGAAGTGAAGGAGCAGAGCGGCCAG
gtaagcgttcgtgggccgtgtgcgagggccgcgtgcaagatgtggagatcagcggcccgc
ggcccgcgccccgtccccaggcgacccggcaggcgcccggagccgggtcccgcagtgctc
gacggcgcggccaggggtaccggaggagccgcaatctctgccttcccactgcgacttcag

 1.02 Intr +   1597   1965  369  0  0   78   89    62 0.526   1.16
tgcaagatgtggagatcagcggcccgcggcccgcgccccgtccccaggcgacccggcagg
cgcccggagccgggtcccgcagtgctcgacggcgcggccaggggtaccggaggagccgca
atctctgccttcccactgcgacttcagttcccctgggcctcactttcctcatccgggcag
TGGGTTGGGCCAGAAAGTGTGCTCGCAGGGGCCGAACTTTGTAATTCCCGCTTCCCTTAC
CTCCACGCCCTTCCTGGTAGCGGGTATTTTAAGTTTCCTAAGTCTCCCGCCACGTGGCTA
GGCTCTGCGCGGCCCCCCCTGGGGCAAGGAGGTTGCTGCGAGTCTCGGGGGTGGATTGCG
ACCAGCCCCTCGGGGGAGCGCCTGGAAAAGGGACCCTACAGCCTCTTAGTTGAGCTGGAA
CTCAGGCCTTTAGCGATTGTCTGTACTGAGACGGTCAGCTTTGGTACTCGAACTCGTGGT
ACAGTCATTTCTTACTTGATTAATTCAACTGTTAATCCGGTACTCAGGGTGCTTCCTGGT
GTTCGAATG
gtgagcaccatctctcagccctcctggagcttacactctagtaaggtagacaaatcaaag
aatcacaaaagtgactatatgcttagcaccgcaataagtgttaagaatgagagggatggg
ccgggcacggtagctcacgcctgtaatcccagcacttagggaggccgagactagcggatc

 1.03 Intr +   4685   4740   56  1  2   96   98    21 0.778   2.17
tcttcctgcctcagcctcccaaagtgctgagattacaggtatgagccaccatgcccagcc
aaaaagaccctcttctgaaccacctgtctatacaagtcatgagtttggggagatctgggc
ccaagaaggatccttactgtgctggggattaattgtggctttctctttacctctctgcag
AAGTGTTTCCTGGCTCAGCCCGTAACCCTTCTGGACATCTATACACACTGGCAACA
gtaagtggtggggcctatagggtggagtagggacggacaccccaagcaactcagcttgga
ataagctgggatacctatctggtctaagatctgtccccatagcccactgtggacaccatt
gttgcctccagaaagccagctcacatcacatggatgggtatttctgtgtggatatctggt

 1.04 Intr +   7642   7833  192  1  0   48   42   243 0.537  14.83
tttatgaagtgagtgaaaatgcagaatacaaaattgtgcctatactgtgttttcaccact
gtttagattctatgcacattgcctttaagagctggaaggatgcgggaaggtctgtctagt
caattcttgtggagttgttctgtcacccagttggtatagacagtcacccttgtcctgcag
AACCTCAGAGCTTGGTCGGAAGCGGAAGGCAGAGGAAGATGCGGCACTGCAAGCTAAGAA
AACCCGTGTGTCAGACCCCATCAGCACCTCGGAGAGCTCGGAAGAGGAGGAAGAAGCAGA
AGCCGAAACCGCCAAAGCCAGTAAGAGCCTTGCAGCTTTGGGAACAGGCTATGGAATATT
GATTGTTCTAGG
gtagagtctacctccagcttcttctcttatcactagaagacctaaaagaccctggggagg
agattgggagggcaccacatatctttggcagtatttgagcccttcctccgtgccaggcat
tatatctccatgctctgggggtgcaaggccgaaccaaaacaaccagatgggcccttccag

 1.05 Intr +   7950   8062  113  0  2   54   60    79 0.616   2.23
ccgccaaagccagtaagagccttgcagctttgggaacaggctatggaatattgattgttc
tagggtagagtctacctccagcttcttctcttatcactagaagacctaaaagaccctggg
gaggagattgggagggcaccacatatctttggcagtatttgagcccttcctccgtgccag
GCATTATATCTCCATGCTCTGGGGGTGCAAGGCCGAACCAAAACAACCAGATGGGCCCTT
CCAGTCTCATTTGGTGTATGGGGCCCAGGAGCTGCCCTATTACAGGCTCCCAG
gtgattcttattagctggaaagaagacacacgttcagaagtactgctggagggatttcag
aaagcagctagcggacacattttctgtgtgacctgtgggatgctttaggaattgctgatc
ttcatgttcatttagaattgtacccattagcactggaacgctgtactgggcactggtttt

 1.06 Intr +  11373  11446   74  1  2   76  113    35 0.852   4.42
ggtggacctggctgatgcatcacagagctcattcctgcaagtctgggctcagcctcagat
cctcatgccagcaccaggcagccaataccaatagaattgttaggtgagatgaaacctgtt
tgccattcatagatgagaaaagctcatctggctcctttagcagatgtttgtttcttgcag
CCCCAAGACTAGCATCTACCAACTCCTCAGTCCTGGGGGCGGACTTGCCATCAAGCATGA
AAGAAAAAGCCAAG
gtgagtgggactgccttccaagctattgcctatgggatttaaggtgcctggtaggggaca
gtcttacatgtcagagaaggatagggttgtgagtaattgccccacctggattcagagctc
aacctgtgtcaccagttgtgggatcttagtcccttcacctctctgggcctcagtttactt

 1.07 Intr +  12245  12431  187  1  1   93   99    92 0.996  10.58
ctctggtgagaggaggtgctgtttttaacctcactttaaagattgggaaacagattgaag
gggtagtttacccaaactcacacagctaagaagtggtaagattgggttcagatgcaagtg
gcctgtgctcttagttcaccatgccataccagatgtgtctgtcactcttgttctctgtag
GCAGAGACAGAGAAAGCTGGCAAGACTGGGAATTCCATGCCACACCCTGCCACTGGGAAG
ACGGTGGCCAACCTTCTTTCTGGGAAGTCTCCCAGGAAGTCAGCAGAGCCCTCAGCAAAT
ACTACGTTGGTCTCAGAAACTGAGGAGGAGGGCAGCGTCCCGGCCTTTGGAGCTGCTGCC
AAGCCTG
gtaagaagtccccacctctaggaacctagtccccagaacttgggctggtgaggcaggcct
aggcattgctttaagttctgggacatttctggaatcaaaagtttgtctccaggacagcca
ggttcctgcatcttaggacttttctcatcacctagacgagggagggtcagcttacaggga

 1.08 Intr +  13058  13131   74  0  2   73   76   105 0.997   7.42
agggatggtgatggtacccacctcagaagggggcttcacagctcagtgcatgtgaggcac
acgaggggtgagcgctcagcacctggctttgatgagcagctggtttgtggggaggtgctg
gggaggggcaggtgaggctggaaagggagtccctcagtcccctccgtgtccgatcctcag
GGATGGTGTCAGCGGGCCAGGCCGACAGCTCCAGCGAGGACACCTCCAGCTCCAGTGATG
AGACAGACGTGGAG
gtaattgccacccatccctaggagttgccctctcccagcctctaacccttccaggaacct
gtctggggcttcagacaccagtgggcccagatgagttcagcaactgtggtagggtgacca
ggagctggaaaggctgcagccggagaggggcagggagaggagtctggtgctgcttgctgc

 1.09 Intr +  15535  15765  231  0  0   98   94   147 0.979  14.80
ctttaagccttgtgtacttttctggaaaatggatctaaagctaatagccgtctcagggag
ttgcttaaaaatccagtgacattaggaaagagctttatcaactgctgaagcccctaatac
agaaccttagggggaaacagtaattattattcattttctaattccatcctcttgttccag
GGGAAACCCTCAGTAAAACCAGCCCAGGTCAAAGCCTCATCAGTTTCTACTAAGGAGTCT
CCAGCAAGAAAGGCGGCCCCAGCCCCTGGGAAGGTGGGGGATGTGACACCCCAGGTCAAA
GGAGGGGCCCTGCCCCCAGCCAAGAGGGCCAAGAAGCCAGAAGAGGAGTCAGAGAGTAGT
GAGGAGGGATCTGAAAGTGAGGAGGAGGCCCCTGCAGGGACACGAAGCCAG
gtgaggcctggaggagggctgccccttggaggacctgcgggtcccccagcagcctgagca
ctctgccatgagcacctctgccactggagttggggagagggaggactatggtgtgaagtt
gaagagcaagaacagcctgcttcccacaggggagtcttgcactccactttgtctgtgacc

 1.10 Intr +  17703  17915  213  2  0   74   94   152 0.838  13.84
ctgatcgatttttgagaaaccaggaggccagtgtggccaaagtatcagtcaaggtgggga
gtggggagggaagcaggggaggtcttaggagcctcattaaggcctctggactttatccta
aaggcatcaccagagagttttcacaagcaggagagcaagctgccctttctttttcaccag
GTAAAGGCCTCTGAAAAAATTCTCCAGGTCAGAGCTGCCTCAGCCCCTGCCAAGGGGACC
CCTGGGAAAGGGGCTACCCCAGCACCCCCTGGGAAGGCAGGGGCTGTAGCCTCCCAGACC
AAGGCAGGGAAGCCAGAGGAGGACTCAGAGAGCAGCAGCGAGGAGTCATCTGACAGTGAG
GAGGAGACGCCAGCTGCCAAGGCCCTGCTTCAG
gtgaggcctgaggagggagactccatgcagccaggcccgtccccagaaggccttctcagg
acttgttctcccactctgggccagagccccgggcgtgcctcagaccccagccccttactc
ccctctcactgtgtggcatcatttgccctatctggtcttctgtacgtggtgtcctgtgtc

 1.11 Intr +  18146  18340  195  1  0  118   94   150 0.999  18.73
ccttctcaggacttgttctcccactctgggccagagccccgggcgtgcctcagaccccag
ccccttactcccctctcactgtgtggcatcatttgccctatctggtcttctgtacgtggt
gtcctgtgtctcctcacacgtccatcctctgggctgtctccccttgtcttgtttctccag
GCGAAGGCCTCAGGAAAAACCTCTCAGGTCGGAGCTGCCTCAGCCCCTGCCAAGGAGTCC
CCCAGGAAAGGAGCTGCCCCAGCGCCCCCTGGGAAGACAGGGCCTGCAGTTGCCAAGGCC
CAGGCGGGGAAGCGGGAGGAGGACTCGCAGAGCAGCAGCGAGGAATCGGACAGTGAGGAG
GAGGCGCCTGCTCAG
gtgaggcagaggggaggggtggagagtagccccatgcctaaaccccagcacctgcatggg
tgtggccacctttgccacatccagctcctgtctccacacgtccaccctctgggctctccc
ctcatcctgtttctcactccaggcgaagccttcagggaaggccccccaggtcagagccgc

 1.12 Intr +  18483  18692  210  2  0  120   94   147 0.998  18.13
gcgaggaatcggacagtgaggaggaggcgcctgctcaggtgaggcagaggggaggggtgg
agagtagccccatgcctaaaccccagcacctgcatgggtgtggccacctttgccacatcc
agctcctgtctccacacgtccaccctctgggctctcccctcatcctgtttctcactccag
GCGAAGCCTTCAGGGAAGGCCCCCCAGGTCAGAGCCGCCTCGGCCCCTGCCAAGGAGTCC
CCCAGGAAAGGGGCTGCCCCAGCACCTCCTAGGAAAACAGGGCCTGCAGCCGCCCAGGTC
CAGGTGGGGAAGCAGGAGGAGGACTCAAGAAGCAGCAGCGAGGAGTCAGACAGTGACAGA
GAGGCACTGGCAGCCATGAATGCAGCTCAG
gtgaggctggaagccgccctgcatggcctgtgccctgcctcaaaagacctcctgtggttt
tgacttttcctctctgaacctagagccctgtgcggctggcttcgtttgctctcctcccct
cactcacattctccttctggactccctccctaatcttgtcctttgtgtctcccaggtgaa

 1.13 Intr +  18868  19083  216  0  0  130   94    70 0.930  11.03
ctcaggtgaggctggaagccgccctgcatggcctgtgccctgcctcaaaagacctcctgt
ggttttgacttttcctctctgaacctagagccctgtgcggctggcttcgtttgctctcct
cccctcactcacattctccttctggactccctccctaatcttgtcctttgtgtctcccag
GTGAAGCCCTTGGGGAAAAGCCCCCAGGTGAAACCTGCCTCTACCATGGGCATGGGGCCC
TTGGGGAAAGGCGCCGGCCCAGTGCCACCCGGGAAGGTGGGGCCTGCAACCCCCTCAGCC
CAGGTGGGGAAGTGGGAGGAGGACTCAGAGAGCAGTAGTGAGGAGTCATCAGACAGCAGT
GATGGAGAGGTGCCCACAGCTGTGGCCCCGGCTCAG
gtgaggccccttcctgtaaggctctttctttttcccccccactcagagtggagctgcctg
tggcctcccaacctcacactgggactctgtctacaatcttagtttcttaatgtctgcaca
cacctaccctgggctccctctcccgatcctgtgtatctcactccaggaaaagtccttggg

 1.14 Intr +  19250  19438  189  1  0  110   94   231 0.999  26.20
tggccccggctcaggtgaggccccttcctgtaaggctctttctttttcccccccactcag
agtggagctgcctgtggcctcccaacctcacactgggactctgtctacaatcttagtttc
ttaatgtctgcacacacctaccctgggctccctctcccgatcctgtgtatctcactccag
GAAAAGTCCTTGGGGAACATCCTCCAGGCCAAACCCACCTCCAGTCCTGCCAAGGGGCCC
CCTCAGAAGGCAGGGCCTGTAGCCGTCCAGGTCAAGGCTGAAAAGCCCATGGACAACTCG
GAGAGCAGCGAGGAGTCATCGGACAGTGCGGACAGTGAGGAGGCACCAGCAGCCATGACT
GCAGCTCAG
gtgaggcctggggaaggaggctgctacatggcctgatctgccacaccacagtcagcaccc
ccggggagctgtgctccctcaggcagagcatgggttttggctggtggggcagaacagatg
ggggactctgagttcaggaaccttctccagcctttctttggtgtcccctcaggcaaaacc

 1.15 Intr +  19611  19859  249  2  0   85   94   146 0.989  13.07
cagctcaggtgaggcctggggaaggaggctgctacatggcctgatctgccacaccacagt
cagcacccccggggagctgtgctccctcaggcagagcatgggttttggctggtggggcag
aacagatgggggactctgagttcaggaaccttctccagcctttctttggtgtcccctcag
GCAAAACCAGCTCTGAAAATTCCTCAGACCAAGGCCTGCCCAAAGAAAACCAATACCACT
GCATCTGCCAAGGTCGCCCCTGTGCGAGTGGGCACCCAAGCCCCCCGGAAAGCAGGAACT
GCGACTTCTCCAGCAGGCTCATCCCCAGCTGTGGCTGGGGGCACCCAGAGACCAGCAGAG
GATTCTTCAAGCAGTGAGGAATCAGATAGTGAGGAAGAGAAGACAGGTCTTGCAGTAACC
GTGGGACAG
gtgaggcctgtgttttctgggcgggcctcagggccgcccctacgtggtcctttggactcc
tggagacacctctcttccccttgtcatcccaggcaaagtctgtggggaaaggcctccagg
tgaaagcagcctcagtgcctgtcaaggggtccttggggcaagggactgctccagtactcc

 1.16 Intr +  19952  20149  198  1  0  103   94   111 0.922  13.27
cacccagagaccagcagaggattcttcaagcagtgaggaatcagatagtgaggaagagaa
gacaggtcttgcagtaaccgtgggacaggtgaggcctgtgttttctgggcgggcctcagg
gccgcccctacgtggtcctttggactcctggagacacctctcttccccttgtcatcccag
GCAAAGTCTGTGGGGAAAGGCCTCCAGGTGAAAGCAGCCTCAGTGCCTGTCAAGGGGTCC
TTGGGGCAAGGGACTGCTCCAGTACTCCCTGGGAAGACGGGGCCTACAGTCACCCAGGTG
AAAGCTGAAAAGCAGGAAGACTCTGAGAGCAGTGAGGAGGAATCAGACAGTGAGGAAGCA
GCTGCATCTCCAGCACAG
gtgaggcctagaaggagcaggcccatcccacccacacctgttcctgagccagggctgagg
atgggcttgactgggggctagtgttgcctgcaggtgtgcagaagcctcagaggtagcctc
aacacagcttccttccctatctttcactccatgtctcctctgcccatcagagctccaggg

 1.17 Intr +  22758  22937  180  2  0   73   94   129 0.909  12.58
ggggccagaagccacaggaggtgtggagggttggggtagagaggaggaccagtcactgag
cccagccaggagaaggtgcgtgcatgggcaggccacccacccagagttgtgccatagtgg
ggagtgggacctgaaaggaatcacttttgcctccaatactattatccccctgcaattcag
GTGAAGCCACCAGTGAGAAACCCCCAGAACAGTACCGTCTTGGCGAGGGGCCCAGCATCT
GTGCCATCTGTGGGGAAGGCCGTGGCTACAGCAGCTCAGGCCCAGACAGGGCCAGAGGAG
GACTCAGGGAGCAGTGAGGAGGAGTCAGACAGTGAGGAGGAGGCGGAGACGCTGGCTCAG

gtgagggggagggaatggagatcatcccctacatgggatgtaacacctttgccacatcca
gctcctgtcttctcacacgtccaccctccaggctctctcctctcatcctgtttctccctc
caggtgaagccttcagggaagacccaccagatcagagctgccttggctcctgccaaggag

 1.18 Intr +  23061  23261  201  2  0  156  110    72 0.999  16.20
tcagggagcagtgaggaggagtcagacagtgaggaggaggcggagacgctggctcaggtg
agggggagggaatggagatcatcccctacatgggatgtaacacctttgccacatccagct
cctgtcttctcacacgtccaccctccaggctctctcctctcatcctgtttctccctccag
GTGAAGCCTTCAGGGAAGACCCACCAGATCAGAGCTGCCTTGGCTCCTGCCAAGGAGTCC
CCCAGGAAAGGGGCTGCCCCAACACCTCCTGGGAAGACAGGGCCTTCGGCTGCCCAGGCA
GGGAAGCAGGATGACTCAGGGAGCAGCAGCGAGGAATCAGACAGTGATGGGGAGGCACCG
GCAGCTGTGACCTCTGCCCAG
gtaagacttgccaggcctctgagccaccaacactcactcctcagaacgggggtatagggc
tgggcgtggtggctcacacctgtaatcctagcactttgggaggccgaggcagatgtatca
cttgaggtcaggggttcaagaccagcctggccaacatggtgaaaccccgtctctactaaa

 1.19 Intr +  26284  26434  151  0  1   61   71    43 0.708   0.15
gtcctcctctgactgcagtgcttgctcatccttccagcccccatcatcacacctgcccca
acaggaggggatggtagccagtggaacacttctaggtggctcctgcttttggctgggggt
gttacaaccggaggtgagctgtgctgggaccactggcttgtgcctgcaaccttgtcccag
GCTGCTGTCACCTCTTGTCGAGACATTGGGCCAACAGCCCTGCAGCCCTCAGGTTTTAGC
TGCATCGGAGTCATAAATCCCTTTCATGTTCGGAGTCAGCTCTGGAAGGAGCTAGCAGGG
TGGAAGCATGTTTCCAGTGGCTGTGGGGCAG
gtcaggccagcaggtatccctgtgcatgtgcaggaaggggccacgctgcctcccctggaa
accagagtgcctgagggtcattgcctactggctgtttccccctcagcaaatgccccactc
cccgaccacgtgcttatccaggtcttgtcccctcagaaggacagtaactccaaacctgcc

 1.20 Intr +  26541  26701  161  1  2   98   85    94 0.874  10.32
tccctttcatgttcggagtcagctctggaaggagctagcagggtggaagcatgtttccag
tggctgtggggcaggtcaggccagcaggtatccctgtgcatgtgcaggaaggggccacgc
tgcctcccctggaaaccagagtgcctgagggtcattgcctactggctgtttccccctcag
CAAATGCCCCACTCCCCGACCACGTGCTTATCCAGGTCTTGTCCCCTCAGAAGGACAGTA
ACTCCAAACCTGCCAGAAGCAAGACCCTGGCCCCAGCACCCCCAGAGAGGAACACGGAGG
GGTCCTCGGAGAGCAGTGAGGAAGAGCTGCCACTGACCCAG
gtgcgccatgccttctctctgcagatgctgcaggatcagagctgggctggcaggccttgc
aggagagggcagatcttgcccatagggaaaatctcgccatatttaaacagcacctcacag
cttccagagctctttcctctattgtgacattcatctgagccctgtgaggcaggcagcagt

 1.21 Intr +  31431  31617  187  2  1   85   93   148 0.987  14.78
ggtcttagcagatgtgtggggtgggagggggcaccctgggcagctggaatggcttctgtg
cccagctgcccctgagctcagtggaccctttgccttgtaaaacactccctaaccccatca
cctcctttccctggccaagcctttaatcactgggggggtgttttgtttttgtttttcaag
GTGATTAAACCCCCTCTGATTTTTGTCGACCCTAATCGTAGTCCAGCTGGCCCAGCTGCT
ACACCCGCACAAGCCCAGGCTGCAAGCACCCCGAGGAAGGCCCGAGCCTCGGAGAGCACA
GCCAGGAGCTCCTCCTCCGAGAGCGAGGATGAGGACGTGATCCCCGCTACACAGTGCTTG
ACTCCTG
gtgagcgcagcccttatgcagtggtgggaggggctgccagcactgccccacattgaggcc
cagaagggacaggacactggctgagtcacatagcaaggtgttggtcgggaggggcttggg
gtcaggtctctgggccctgcattagccattctgattagggcctggctcagacctgcagtt

 1.22 Intr +  33416  33552  137  0  2  104   82   100 0.945  11.80
gacataatgacatctcctgcctgggaggcttggagagggaagtaaacaagcttctacctc
tgtaagccctgagcacagctctagatcaccagcacaggccggtaaattgggttattgccg
ctgctgaggaggcgatggggcttttgtgccctgatgtgcccccatctcgctccatttcag
GCATCAGAACCAATGTGGTGACCATGCCCACTGCCCACCCAAGAATAGCCCCCAAAGCCA
GCATGGCTGGGGCCAGCAGCAGCAAGGAGTCCAGTCGGATATCAGATGGCAAGAAACAGG
AGGGACCAGCCACTCAG
gtacctggtgggcaagggagggtaatgcaggccagtggggtggggccctacttccatact
tacccacatgtgctgatgggatggcctgcaattgctgtcacgcccacactccagaggtcg
tggcctcacagccagaggctttctggcctcctagctacaaccccccaaatcacctttgag

 1.23 Intr +  35073  35186  114  2  0   89   72    20 0.751   1.65
gctccttgagaacaatgtgattcgctcataacctgaagcctgccaccagttttgcccctt
tgactgcccctcagtccctgctccagccctcaccccagccagacagcatctgaccagggt
gtggcacagctggcatcccaaggacttgtgagtctgagggctacctcttgccacccacag
GTGTCAAAGAAGAACCCAGCTTCCCTCCCACTGACCCAGGCTGCCCTGAAGGTCCTCGCC
CAGAAAGCCAGTGAGGCTCAGCCTCCTGTTGCCAGGACCCAGCCTTCAAGTGGG
gtgagcttggggagccaggggaagcaagcccacggagcgtagaaggtgcaggcgtggccc
tgcatcgcggcaccagcactcatctgccccatgacctctgcacttggtttgcctccctcg
gcctcagtggcctaatctgtaagaaggaattacagtacctttcgtagttggaaggatcaa

 1.24 Intr +  35486  35705  220  1  1   44   68   214 0.832  13.40
ggcctcagtggcctaatctgtaagaaggaattacagtacctttcgtagttggaaggatca
aatgaggctgcatgtgtgccccatctaacacagttcctggccctactgaagtgttcagga
aggaccaggtcttacttgccctaatttttccttccattccttctcctttcaccgaattag
GTTGACAGTGCTGTGGGAACACTCCCTGCAACAAGTCCCCAGAGCACCTCCGTCCAGGCC
AAAGGGACCAACAAGCTCAGAAAACCTAAGCTTCCTGAGGTCCAGCAGGCCACCAAAGCC
CCTGAGAGCTCAGATGACAGTGAGGACAGCAGCGACAGTTCTTCAGGGAGTGAGGAAGAT
GGTGAAGGGCCCCAGGGGGCCAAGTCAGCCCACACGCTGG
gtgagggtgccaggggaaaggcaagggtgggccaggaagagggtgttgtgtggcctggtg
gagccatagctctggcctcagctccatatctcagactcattctgcacctgtggctgagcc
tgggcctcagtttccccacctgtacaacttcatgaggaagtcaatccaaatgatttcaga

 1.25 Intr +  36914  37081  168  0  0   90  111    51 0.403   8.03
agggctgaagtgctgctctgtgccttgttgtccacccactctgcactgatagggcagggt
gatcctagaggccccaggctgctttcctcacagcaggccatgactcgggctgggttatgg
cagtggggtggggtggtggcagcctctttcacaatgggcttcttcagtctctcctctcag
GTTATATGACCCCTGGACTAACCCCAGCCAATTCCCAGGCCTCAAAAGCCACTCCCAAGC
TAGACTCCAGCCCCTCAGTTTCCTCTACTCTGGCCGCCAAAGATGACCCAGATGGCAAGC
AGGAGGCAAAGCCCCAACAGGCAGCAGGCATGTTGTCCCCTAAAACAG
gtaagttaaggtctgcaggagggacatagcaggacacagagggacagggcagtgggcccc
ttcttgccctcctgtagcaacagtcctcccaacatggtcctgtctgcccccagagcctct
ccaagtgagaccttgtggccttgcattggacctgaagatgctcatcaaagtgcaggtggg

 1.26 Intr +  37195  37266   72  2  0   80   61    43 0.573   0.67
gatgacccagatggcaagcaggaggcaaagccccaacaggcagcaggcatgttgtcccct
aaaacaggtaagttaaggtctgcaggagggacatagcaggacacagagggacagggcagt
gggccccttcttgccctcctgtagcaacagtcctcccaacatggtcctgtctgcccccag
AGCCTCTCCAAGTGAGACCTTGTGGCCTTGCATTGGACCTGAAGATGCTCATCAAAGTGC
AGGTGGGGCCAG
gtgcagtggctcatgcccataatcccagcactttgggaggccgaggtgggcagattgctc
aagcccaggagttcaaggccagcctgggcaacacagagagaccccatctctaaaatttat
tttaattagccggtgtgatggtgcacgcttgtagtcccaattacttgagaggccaaggca

 1.27 Term +  39811  40379  569  2  2  126   47   524 0.920  47.08
gtggaaaggtgtgagcttaggagaccagctggggcagagtgaccgccaagccttgctctc
cccatctgtgccattgtaagaaaagatggagtcactccctgcaccctcttcgctcttagg
taccataagatctgtcccccaactctcccagatctgtgaccccacattctctctccatag
GTGGAAAAGAGGCTGCTTCAGGCACCACACCTCAGAAGTCCCGGAAGCCCAAGAAAGGGG
CTGGGAACCCCCAAGCCTCAACCCTGGCGCTGCAAAGCAACATCACCCAGTGCCTCCTGG
GCCAACCCTGGCCCCTGAATGAGGCCCAGGTGCAGGCCTCAGTGGTGAAGGTCCTGACTG
AGCTGCTGGAACAGGAAAGAAAGAAGGTGGTGGACACCACCAAGGAGAGCAGCAGGAAGG
GCTGGGAGAGCCGCAAGCGGAAGCTATCGGGAGACCAGCCAGCTGCCAGGACCCCCAGGA
GCAAGAAGAAGAAGAAGCTGGGGGCCGGGGAAGGTGGGGAGGCCTCTGTTTCCCCAGAAA
AGACCTCCACGACTTCCAAGGGGAAAGCAAAGAGAGACAAAGCAAGTGGTGATGTCAAGG
AGAAGAAAGGGAAGGGGTCTCTTGGCTCCCAAGGGGCCAAGGACGAGCCAGAAGAGGAGC
TTCAGAAGGGGATGGGGACGGTTGAAGGTGGAGATCAAAGCAACCCAAAGAGCAAGAAGG
AGAAGAAGAAATCCGACAAGAGTGAGTGA
ccgcttctcccagcccaccccaagggctgctgggcaccccacgggggcgggagggaccct
cagccagcacctggtctcattcctcccatgtagaaaagagaggctgagaccagcctggcc
aacatggcaaaaccccgtctctactaaaaatacaaaaaattagctggatgtggtggcggg

 2.03 PlyA -  41459  41454    6                               1.05
 2.02 Term -  42169  42096   74  2  2   95   48    54 0.682   0.46
 2.01 Intr -  44289  44221   69  1  0   99   89    50 0.796   5.85

Predicted peptide sequence(s):


>TCOF1_1|GENSCAN_predicted_peptide_1|1677_aa
MAEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQWVGPESVLAGAELCNSRFPYLHAL
PGSGYFKFPKSPATWLGSARPPLGQGGCCESRGWIATSPSGERLEKGPYSLLVELELRPL
AIVCTETVSFGTRTRGTVISYLINSTVNPVLRVLPGVRMKCFLAQPVTLLDIYTHWQQTS
ELGRKRKAEEDAALQAKKTRVSDPISTSESSEEEEEAEAETAKASKSLAALGTGYGILIV
LGHYISMLWGCKAEPKQPDGPFQSHLVYGAQELPYYRLPAPRLASTNSSVLGADLPSSMK
EKAKAETEKAGKTGNSMPHPATGKTVANLLSGKSPRKSAEPSANTTLVSETEEEGSVPAF
GAAAKPGMVSAGQADSSSEDTSSSSDETDVEGKPSVKPAQVKASSVSTKESPARKAAPAP
GKVGDVTPQVKGGALPPAKRAKKPEEESESSEEGSESEEEAPAGTRSQVKASEKILQVRA
ASAPAKGTPGKGATPAPPGKAGAVASQTKAGKPEEDSESSSEESSDSEEETPAAKALLQA
KASGKTSQVGAASAPAKESPRKGAAPAPPGKTGPAVAKAQAGKREEDSQSSSEESDSEEE
APAQAKPSGKAPQVRAASAPAKESPRKGAAPAPPRKTGPAAAQVQVGKQEEDSRSSSEES
DSDREALAAMNAAQVKPLGKSPQVKPASTMGMGPLGKGAGPVPPGKVGPATPSAQVGKWE
EDSESSSEESSDSSDGEVPTAVAPAQEKSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAE
KPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTASAKVAPVRVG
TQAPRKAGTATSPAGSSPAVAGGTQRPAEDSSSSEESDSEEEKTGLAVTVGQAKSVGKGL
QVKAASVPVKGSLGQGTAPVLPGKTGPTVTQVKAEKQEDSESSEEESDSEEAAASPAQVK
PPVRNPQNSTVLARGPASVPSVGKAVATAAQAQTGPEEDSGSSEEESDSEEEAETLAQVK
PSGKTHQIRAALAPAKESPRKGAAPTPPGKTGPSAAQAGKQDDSGSSSEESDSDGEAPAA
VTSAQAAVTSCRDIGPTALQPSGFSCIGVINPFHVRSQLWKELAGWKHVSSGCGAANAPL
PDHVLIQVLSPQKDSNSKPARSKTLAPAPPERNTEGSSESSEEELPLTQVIKPPLIFVDP
NRSPAGPAATPAQAQAASTPRKARASESTARSSSSESEDEDVIPATQCLTPGIRTNVVTM
PTAHPRIAPKASMAGASSSKESSRISDGKKQEGPATQVSKKNPASLPLTQAALKVLAQKA
SEAQPPVARTQPSSGVDSAVGTLPATSPQSTSVQAKGTNKLRKPKLPEVQQATKAPESSD
DSEDSSDSSSGSEEDGEGPQGAKSAHTLGYMTPGLTPANSQASKATPKLDSSPSVSSTLA
AKDDPDGKQEAKPQQAAGMLSPKTEPLQVRPCGLALDLKMLIKVQVGPGGKEAASGTTPQ
KSRKPKKGAGNPQASTLALQSNITQCLLGQPWPLNEAQVQASVVKVLTELLEQERKKVVD
TTKESSRKGWESRKRKLSGDQPAARTPRSKKKKKLGAGEGGEASVSPEKTSTTSKGKAKR
DKASGDVKEKKGKGSLGSQGAKDEPEEELQKGMGTVEGGDQSNPKSKKEKKKSDKSE

>TCOF1_1|GENSCAN_predicted_peptide_2|47_aa
XHTQDIILSFMFIHFLPSPPQNHGHFYGFHVLREHALPASSLVCHNP