GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:09:02

Sequence SPRY4_1 : 16959 bp : 50.95% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1332   1358   27  2  0   71  106    33 0.699   3.10
taaaaaagccattttcccaggcagtggttgcaacatcgccgcggaggtagcgagctgagc
tgacagcgcggagctggcgctgtggagcgcagggagccttgccggttcctccgaccggcg
tctgcgagtacagcggcggctaacctgccccggcttcaggatttacacagacgtggggcg
ATGCTTGTGACCCTGCAGCTCCTCAAA
gtaagtccatggctggtttggagatctgaaactgcccctctctgagccgcgacgcgactc
cccccttgggctggggcaaatggtgcgctatttctaggcgcgcctcagtgttccttccct
cagcctgcgcctccttgagtcgctgcggtgcgccgcagctccctgacgccctcggcccgg

 1.02 Intr +   6612   6639   28  2  1  116   75    22 0.128   1.39
gcctgatgctcagccccctccccacaggtacaaatgcagtgagtgtcagactggctggtt
ctgggctcccagacccgccaagcagcaaatacagtgttgcgcgtgttctggggattttga
tatcctgctgattcagtattctaggactctctgtgccctggctccctcccttcctcacag
ACCTGGGCCAGGGACCCCATCAATGAAG
gtaccctagggacccttaagttcaacttgataggtggggaggagtagagattcctttcca
ccccagggtttccttttggggactggtttgtaataaactcctacaagtgaaatccattca
actataagaaaactaaaaatgaaaccacttttaagacgggggatggcatgtaacactgaa

 1.03 Term +  11047  11993  947  2  2   95   48   990 0.220  87.95
gacttcttgtcattattaatcatcttaagcttggggagtcactggaaagtccacagaggg
attttagttcctatgtcaattgggcggctcccaaggacctgatggggggtgaggtattgg
caggccacatactgatgcctggaatccattctctcttccttttccccaccccacccccag
GGCCCCTAGAAGCCTGTTTCTCCGTACAGTCCAGGACCTCCAGCCCCATGGAGCCCCCGA
TCCCACAGAGCGCCCCCTTGACTCCCAACTCAGTCATGGTCCAGCCCCTTCTTGACAGCC
GGATGTCCCACAGCCGGCTCCAGCACCCACTCACCATCCTACCCATTGACCAGGTGAAGA
CCAGCCATGTGGAGAATGACTACATAGACAACCCTAGCCTGGCCCTGACCACCGGCCCAA
AGCGGACCCGGGGCGGGGCCCCAGAGCTGGCCCCGACGCCCGCCCGCTGTGACCAGGATG
TCACCCACCATTGGATCTCCTTCAGCGGGCGCCCCAGCTCTGTGAGCAGCAGCAGCAGCA
CATCCTCTGACCAACGGCTCTTAGACCACATGGCACCACCACCCGTGGCTGACCAGGCCT
CACCAAGGGCTGTGCGCATCCAGCCCAAGGTGGTCCACTGCCAGCCGCTGGACCTCAAGG
GCCCGGCGGTCCCACCCGAGCTGGACAAGCACTTCTTGCTGTGCGAGGCCTGTGGGAAGT
GTAAATGCAAGGAGTGTGCATCCCCCCGGACGTTGCCTTCCTGCTGGGTCTGCAACCAGG
AGTGCCTGTGCTCAGCCCAGACTCTGGTCAACTATGGCACGTGCATGTGTTTGGTGCAGG
GCATCTTCTACCACTGCACGAATGAGGACGATGAGGGCTCCTGCGCTGACCACCCCTGCT
CCTGCTCCCGCTCCAACTGCTGCGCCCGCTGGTCCTTCATGGGTGCTCTCTCCGTGGTGC
TGCCCTGCCTGCTCTGCTACCTGCCTGCCACCGGCTGCGTGAAGCTGGCCCAGCGTGGCT
ACGACCGTCTGCGCCGCCCTGGTTGCCGCTGCAAGCACACGAACAGCGTCATCTGCAAAG
CAGCCAGCGGGGATGCCAAGACCAGCAGGCCCGACAAGCCTTTCTGA
cagtttgtgtcgaagccccagtgctctgcctggaaacctggttctcttctgacatctaag
aagactgcagcaaggtcagaggttttagcctcctgaggctgaccttgctagtctgcccac
tccctacccccagcttcggaaaatacagagaccaccaccacgtaccctgtattccccaag

Predicted peptide sequence(s):


>SPRY4_1|GENSCAN_predicted_peptide_1|333_aa
MLVTLQLLKTWARDPINEGPLEACFSVQSRTSSPMEPPIPQSAPLTPNSVMVQPLLDSRM
SHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVT
HHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGP
AVPPELDKHFLLCEACGKCKCKECASPRTLPSCWVCNQECLCSAQTLVNYGTCMCLVQGI
FYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGALSVVLPCLLCYLPATGCVKLAQRGYD
RLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF