GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:48:06

Sequence SLC22A5_1 : 28259 bp : 48.03% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1422   1814  393  2  0   88   90   805 0.785  77.44
taaggccagccgcggcaggaccaaggcggcggtgtcagctcgcgagcctaccctccgcgg
acggtcttgggtcgcctgctgcctggcttgcctggtcggcggcgggtgccccgcgcgcac
gcgcaaagcccgccgcgttccccgaccccaggccgcgctctgtgggcctctgagggcggc
ATGCGGGACTACGACGAGGTGACCGCCTTCCTGGGCGAGTGGGGGCCCTTCCAGCGCCTC
ATCTTCTTCCTGCTCAGCGCCAGCATCATCCCCAATGGCTTCACCGGCCTGTCCTCCGTG
TTCCTGATAGCGACCCCGGAGCACCGCTGCCGGGTGCCGGACGCCGCGAACCTGAGCAGC
GCCTGGCGCAACCACACTGTCCCACTGCGGCTGCGGGACGGCCGCGAGGTGCCCCACAGC
TGCCGCCGCTACCGGCTCGCCACCATCGCCAACTTCTCGGCGCTTGGGCTGGAGCCGGGG
CGCGACGTGGACCTGGGGCAGCTGGAGCAGGAGAGCTGTCTGGATGGCTGGGAGTTCAGT
CAGGACGTCTACCTGTCCACCATTGTGACCGAG
gtgggtgccggcccctgctggggctgagaccagggctcggaggacctgtcgcggtccttg
aacccgagctcctctctcccagatgcgcactggacgctgtcactccccctcccccaacgg
tcaacaccctagcgatggagaccctccagccaggtggcttgggaacgcttcacgaggtga

 1.02 Intr +   2027   2115   89  1  2   97   23    37 0.579  -3.13
gggctcggaggacctgtcgcggtccttgaacccgagctcctctctcccagatgcgcactg
gacgctgtcactccccctcccccaacggtcaacaccctagcgatggagaccctccagcca
ggtggcttgggaacgcttcacgaggtgacctccagccacagtgtgctcctccctgcacag
GTGGTCAGTCTGGCCTCCCGTCCTGATGGCCACTTTGAAGAGGGTACCAGGAAGGTCCTG
GCGGTCCCTGGGCGATGCTCTATGGCCCT
gtgtgtccaggacttactctagttggggttgggggtggtaagtagcagagccaggacttg
ggccaggggctatcccgtttttcctctagtctcttgatttctttttagaagagaagaaat
acttctctttcctgaacttttaaaagttaaataaagcatgtgtatacaactgcctcttcc

 1.03 Intr +   2309   2361   53  2  2  100   95    62 0.595   6.65
ttactctagttggggttgggggtggtaagtagcagagccaggacttgggccaggggctat
cccgtttttcctctagtctcttgatttctttttagaagagaagaaatacttctctttcct
gaacttttaaaagttaaataaagcatgtgtatacaactgcctcttccctttttcctctag
TTACTCCTTCCCCTACCGTCCACAACCCAAAAACGACAATCTGGTCATGCCCT
gtaagtaattgtttgccttttcccatggtcagttgtcagtcttttttttttttgagacag
agtctccctctgtcaccaggctggagcgcagtcgtgtgttcttggctcactgcaaccttc
gcagtcgtgcgttcttggctcactgcaatcttcgccttccgggctcaagtgattctcctg

 1.04 Term +   2995   3017   23  2  2  115   45    -2 0.465  -3.33
atttagttaaagcatacagccttaggtcatagggtgtaggggagcctttctcatttctca
tccccttggattttccctctgggtggttttgtctgtcccctccgaacctgttggagcagt
tgttggagctggatgtaggaacatgatgttaatgatgtatgtgttttgtgtcttttttag
ACACTGGCACTCTAGCTCCCTGA
agtttcagcagcattgagtaagtagccagtgaatagccctcattgatagataggctcact
aaatgtgcagatgaccaattcgcaggttagagaaggcttcccagaagaggaggcctctcc
gtgagcctagggtgttcagctcagcataatagtgagctgaaggccccagtgcagcagcaa

 2.01 Init +   9649   9684   36  0  0   57   99    56 0.879   1.69
ctgagcgagggtgccctgcctcttccacagccctgggctccgctcagatttttaggagca
agcgttagaggccttgctttctccagggtcagcatgtggacagaacacttactctctgcc
tgtctctcctcctcaaaatggaagcaagacagtggggcctacaatgctatgaaaaacagg
ATGGGAAAGAAGCCTGCTCTCTGCCTTCCTGCCCAG
gtgagccatcacctgactaagtgagttcacactcagagcgtgtggggatggcaggatgtt
ctgacttcattttccaggatgcctttgctttaaaaccttttaaaaagaagtgaatgatac
accccctttgctcatcttgcagtggaacctggtgtgtgaggacgactggaaggccccact

 2.02 Intr +   9827   9930  104  1  2   66  110   128 0.967  11.77
ggatgggaaagaagcctgctctctgccttcctgcccaggtgagccatcacctgactaagt
gagttcacactcagagcgtgtggggatggcaggatgttctgacttcattttccaggatgc
ctttgctttaaaaccttttaaaaagaagtgaatgatacaccccctttgctcatcttgcag
TGGAACCTGGTGTGTGAGGACGACTGGAAGGCCCCACTCACAATCTCCTTGTTCTTCGTG
GGTGTGCTGTTGGGCTCCTTCATTTCAGGGCAGCTGTCAGACAG
gtaaggtgtctgtcttctggagcaccaggggacctcagcactgaggaagaagcgtgtgcc
tggcccttgatttcagttggtagtattctttcagcgcagggccctgtattttaaagaaga
ggaagctatgtctgtgatatagactccatgcctagtaagaagagccaacaaatctgactc

 2.03 Intr +  15596  15750  155  2  2  127   51   236 0.964  23.52
gtggggagggggagaaatagcatgggcactgtgagaccgagactgtccctggcagccagt
attctggcaacactgttcacacccacttactggatggatcttgagaaagccccacttggt
ggagcccattcctgctgcccttttccagctggttatctgtcactctccttttcttcccag
GTTTGGCCGGAAGAATGTGCTGTTCGTGACCATGGGCATGCAGACAGGCTTCAGCTTCCT
GCAGATCTTCTCGAAGAATTTTGAGATGTTTGTCGTGCTGTTTGTCCTTGTAGGCATGGG
CCAGATCTCCAACTATGTGGCAGCATTTGTCCTGG
gtatgaccatcaggttggagttgagtacttgatcctgtatttcaccatcatcccatcacc
tacctttctggagacaactgtgatgtccctcaagggggacagggtttctaacaaaactag
ccagagcttcctggtgaaccttacttacaggcagggaaactgagccagacatgagaccag

 2.04 Intr +  16777  16948  172  2  1   94   89    95 0.659   9.20
tgtacccccaggagacagtcagacaggaggggttcagaacgccatccgctccctagcgcc
atgaacttagagagagttctcgctgttttcttgtctgtgtattcacaaagataccataaa
aaattaataaggaaggaacccaaattaaactgctaactcgacctcccttgttttgaacag
GGACAGAAATTCTTGGCAAGTCAGTTCGTATAATATTCTCTACGTTAGGAGTGTGCATAT
TTTATGCATTTGGCTACATGGTGCTGCCACTGTTTGCTTACTTCATCCGAGACTGGCGGA
TGCTGCTGGTGGCGCTGACGATGCCGGGGGTGCTATGCGTGGCACTCTGGTG
gtgagtgtgaccttgtgccccatgtgcccactggcaggatgatttctgtctggccttcac
tagagggcagcaacaacccatgaatccctattttgtctcccagagacaggaagcatagat
tataaattatttcagaatgttttctccacactcaaaagagccaaaacaaaacagaatccc

 2.05 Intr +  18474  18600  127  0  1   47   99   161 0.734  13.78
ctcatccaccccaggttattgctgcgtgtggatcagctctttgcttctggcttgtgatca
ccaaacattccacaagctctggttctgcaaccttattcccacctatggctgtgctctacc
tggtctgtgggtctgctgttggcagggaggcctcactgagattggaccttgtactgccag
GTTCATCCCTGAGTCCCCCCGATGGCTCATCTCTCAGGGACGATTTGAAGAGGCAGAGGT
GATCATCCGCAAGGCTGCCAAAGCCAATGGGATTGTTGTGCCTTCCACTATCTTTGACCC
GAGTGAG
gtaagcaccatgtgggtgtgggtgagagggacagactgaccgtgatttgagagcagcagc
acccagccctgaagtcctccctgctcacagcagcccagccctctctccgcccaagcccca
actgcccattccccccatccccccactccccacccccacacgggccctgttaacactcag

 2.06 Intr +  20370  20470  101  2  2   62   68   156 0.991   9.91
ggcctagggaagttttcacagcctaaaacacagtcagtatacttactgttcttagaaacg
taacactccccgacgctgagatgcagacagctaagatgccagggattcaagtatgttatt
gtgtgctctgagtctctgaccacctcttcttcccatacacttatgatgttgttcctgcag
TTACAAGACCTAAGTTCCAAGAAGCAGCAGTCCCACAACATTCTGGATCTGCTTCGAACC
TGGAATATCCGGATGGTCACCATCATGTCCATAATGCTGTG
gtatgtaaaagagacctgcctgaggcttccagacaaagcttcttgaagtggccattgggc
ctcttgtttacagacatgcctcagacaaaattcaaagcctatgtcatcagagagtgaaaa
ggatatgtcttgtgttagatggaaaaaatgggcatgtcacaattcttaatgggatggaac

 2.07 Intr +  22139  22353  215  2  2   84   91   130 0.970  11.26
gctggggaaaattatcttttgatctatgaagtaagacgcagggttacagttactgctgcc
ttactagtctctgcttaaagatggtttggaatttactgaaataattgcattgtaaaagtt
gtacaggttgggaaagatgtggatactgcttttccagctttcttctgcactctgtttcag
GATGACCATATCAGTGGGCTATTTTGGGCTTTCGCTTGATACTCCTAACTTGCATGGGGA
CATCTTTGTGAACTGCTTCCTTTCAGCGATGGTTGAAGTCCCAGCATATGTGTTGGCCTG
GCTGCTGCTGCAATATTTGCCCCGGCGCTATTCCATGGCCACTGCCCTCTTCCTGGGTGG
CAGTGTCCTTCTCTTCATGCAGCTGGTACCCCCAG
gtagggaccatgtgcatctatggtttggggtcttcactgagtctcttactgtctaccagg
ctgtctcaattaataaagagaataaaatcaagcccatcacagctcccttgcttatataca
ttcttggcctaaaaatcaatagaaagtgtcttctgagactagaacacttatggcctgggc

 2.08 Intr +  23882  24064  183  0  0  110  111   168 0.996  21.06
agcctcctttcagcaatcaatttggagggaaatcttggctatagccccttcccccacaat
aggaagtgatagaaactgactccccaaaaaatttgggaagaaagtatgtttgttttgctc
tcaatagctgcatgccatgggttggtacctactcctaccctctttcctttgcttctccag
ACTTGTATTATTTGGCTACAGTCCTGGTGATGGTGGGCAAGTTTGGAGTCACGGCTGCCT
TTTCCATGGTCTACGTGTACACAGCCGAGCTGTATCCCACAGTGGTGAGAAACATGGGTG
TGGGAGTCAGCTCCACAGCATCCCGCCTGGGCAGCATCCTGTCTCCCTACTTCGTTTACC
TTG
gtaagtcccatgagccaagggcacactagagcaacgggatggaagtactaactggcttga
atgtgagctggaggttgcgtgttaacaggaaaacaagttcatacagtacatgggctccat
ccagtactggatctttggccgggaagggttcttgtcccagtgcactggccctcactttca

 2.09 Intr +  25125  25260  136  1  1   97   90   203 0.770  21.03
agctctgggttctgaaacctgtctagatgccagattctaatctgactgctcagactgtga
gagatgtgagaccaagaaggaaagtgatccccttccagagtcctgggagcataaaggggt
agatgagagaccaagtctaactgcagccctgggcctgaggctccgtctgctttgccatag
GTGCCTACGACCGCTTCCTGCCCTACATTCTCATGGGAAGTCTGACCATCCTGACAGCCA
TCCTCACCTTGTTTCTCCCAGAGAGCTTCGGTACCCCACTCCCAGACACCATTGACCAGA
TGCTAAGAGTCAAAGG
gtaagaagacctcctctgtcagtgttgatgcactgggtctgggtctggccaggtctcagg
agcccctcacaatagagctactcgcaaactccctctcacagacaccatggactagtttag
ccattaaagggttgtaaatggcaaggtgcttacttatagcccatcctctctggtctgttc

Predicted peptide sequence(s):


>SLC22A5_1|GENSCAN_predicted_peptide_1|185_aa
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTIVTEVVSLASRPDGHFEEGTRKVLAVPGRCSMALYSFPYRPQPKNDNLVMPYT
GTLAP

>SLC22A5_1|GENSCAN_predicted_peptide_2|410_aa
MGKKPALCLPAQWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGM
QTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFY
AFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRK
AAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYF
GLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQL
VPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPY
FVYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKX