GENSCAN 1.0	Date run: 16-Jan-104	Time: 11:38:12

Sequence OTP_1 : 12384 bp : 49.01% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1349   1385   37  1  1   72   95    39 0.830   2.62
cgtctctctaaaggacattataatgcaagaagccccctttttaaccacaaaccgaatttt
ctttcatttaggtgatctatatatatctatatcgtatagcttatagcttatatctatttt
aaataacttaaagccgctaaaatttgggggggaacagctttcgccctggagcggtgcgcg
ATGCTGTCTCATGCCGACCTCCTGGACGCCAGGCTAG
gtgagtgcgcgcctctcgcccgggcagccaggagaagccggggcaggaaattgtcaattt
gttccttattttaccttaatgcgacctaaatggactaatttctttaaaagtaattgtgct
gcattaaagtttaatttgatttaacatcgcctttaaaaaaaaatctatggaatatgtaga

 1.02 Intr +   2668   3077  410  2  2   96   96   629 0.570  58.49
tattccaacccggctgtccaaattctggggaacccagctgaataccctgggagtttcttc
cttaggacaagcgcgggtgcggagggggccgaggacgggttgaaggaaggctgcgcgggg
aagacagcccctcctggcatcgccaagaaagtagtgaccgcgatccccttgcctcctcag
GTATGAAAGATGCCGCCGAGCTTCTGGGCCACCGGGAGGCGGTGAAGTGTAGGCTGGGCG
TGGGGGGCTCCGACCCCGGGGGCCATCCGGGGGACCTGGCGCCCAACTCTGACCCAGTGG
AGGGAGCCACTCTGCTGCCCGGGGAGGACATCACCACAGTGGGCTCTACTCCGGCCTCGC
TGGCGGTGAGCGCCAAAGACCCGGACAAGCAGCCCGGGCCCCAGGGCGGCCCGAACCCCA
GCCAAGCCGGCCAGCAGCAGGGCCAACAGAAGCAGAAGCGCCACCGGACGCGCTTCACCC
CCGCACAGCTCAACGAGTTGGAGAGGAGCTTCGCCAAGACTCACTACCCCGACATCTTTA
TGCGTGAGGAGCTGGCACTGCGTATCGGGCTGACCGAGTCCCGAGTGCAG
gtacgaggggcttgggatctgggacagaaggcaaggacagggcgggaggatttgggcaaa
gggagcagggtcttcccttcccctgtcgagatcctgggctgctttcaggctgcctgtgcg
ttcctgtatcgagttatctccttctctacccggaaactggtccccatcgccatcccccaa

 1.03 Term +   9104   9634  531  1  0   92   38   710 0.997  60.65
ggagttggtggggagccacagtctccggctgggtatgggggcttgtcgggcctacggcac
ttgttcctcccagggcagagcggctgtatccgaggcgggtttctggggctcaagccccaa
ctccccagccgccgggccggctaatagctccctgtctgtctcccgccccgcccgctccag
GTCTGGTTCCAGAACCGACGCGCCAAGTGGAAGAAGCGCAAAAAGACGACCAACGTGTTC
CGTGCGCCCGGCACACTGCTGCCCACGCCAGGCCTGCCTCAGTTCCCGTCGGCTGCCGCC
GCCGCTGCCGCCGCCATGGGCGACAGCCTGTGCTCTTTCCACGCCAACGACACCCGCTGG
GCGGCGGCCGCCATGCCTGGCGTGTCACAGCTGCCTCTGCCGCCGGCGCTGGGCAGGCAG
CAGGCCATGGCGCAGTCGCTGTCCCAGTGCAGCCTGGCGGCCGGTCCGCCGCCCAACTCC
ATGGGCCTGTCCAACAGCCTGGCGGGTTCCAACGGCGCGGGGCTGCAGTCGCACCTCTAC
CAGCCCGCCTTCCCCGGCATGGTGCCCGCCTCCCTCCCCGGCCCCAGCAACGTCTCCGGT
TCGCCCCAGCTCTGCAGCTCCCCGGACAGCAGCGACGTGTGGCGGGGCACCAGCATCGCC
TCCCTCCGCCGCAAGGCGCTAGAGCACACAGTCTCTATGAGCTTCACTTAA
tgcagccgcgccccggcccgctccgcccccagcaccgccccgggggccgccccgaggccc
ttccggcgcgcacccggaccccggcgccctgccccgtcccgccccggccttcgccccgtc
tcgtttcgtcctcgcctctctcctccactcgctcgggctcaccccaagccccagcccgcg

Predicted peptide sequence(s):


>OTP_1|GENSCAN_predicted_peptide_1|325_aa
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPG
EDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELE
RSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPG
LPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCS
LAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSS
DVWRGTSIASLRRKALEHTVSMSFT