GENSCAN 1.0	Date run: 16-Jan-104	Time: 11:51:37

Sequence MEF2C_1 : 165258 bp : 36.14% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.04 PlyA -    517    512    6                               1.05
 1.03 Term -   1273    884  390  1  0  -35   49   456 0.014  23.40
 1.02 Intr -  11135  11062   74  0  2   33  107    53 0.009  -0.09
 1.01 Init -  27411  27246  166  0  1   87   53   111 0.202   7.39
 1.00 Prom -  29949  29910   40                              -4.95

 2.03 PlyA -  30046  30041    6                               1.05
 2.02 Term -  33511  33461   51  1  0   75   32    81 0.347  -2.35
 2.01 Init -  39244  39026  219  1  0   80   93   123 0.846  10.68
 2.00 Prom -  51589  51550   40                              -6.65

 3.01 Init +  60620  60673   54  1  0   80  109    59 0.889   8.53
gctgttagagtggtatttaatttttcttttttgttcagcaggaacgaatgcaggaatttg
ggaactgagctgtgcaagtgctgaagaaggagatttgtttggaggaaacaggaaagagaa
agaaaaggaaggaaaaaatacataatttcagggacgagagagagaagaaaaacggggact
ATGGGGAGAAAAAAGATTCAGATTACGAGGATTATGGATGAACGTAACAGACAG
gtgagtggagtaaactttttttgtatcattatttattaattatattttctccacatatgt
taagggtacagaaaatatcttgaatctgtaaatatctattaagagaagtttgggttaatt
aaatgtgaccagttaaagtgctgatagtctcttatatataaaggagaaaaaaatcacttt

 3.02 Intr +  79607  79810  204  1  0  115   78   309 0.757  31.07
ttttcaaatgataagcagaaattaatattagatttatttgctttctttctgaatgtgtta
gtgcccagggctctgacaactacacaccattgttttgtgaaggaaaagaaaaaagaaaag
aaaaaaaccacacatgcatgaatattttttaaaaaatcttggctgctttcttttttctag
GTGACATTTACAAAGAGGAAATTTGGGTTGATGAAGAAGGCTTATGAGCTGAGCGTGCTG
TGTGACTGTGAGATTGCGCTGATCATCTTCAACAGCACCAACAAGCTGTTCCAGTATGCC
AGCACCGACATGGACAAAGTGCTTCTCAAGTACACGGAGTACAACGAGCCGCATGAGAGC
CGGACAAACTCAGACATCGTGGAG
gtgagagagcatgcgtggtgagccccaagcctccgcaagcaggggagtttggacctcccc
ctgccacacacacatacacacatcatgttctttttcttaagatgttcatagtcccataga
tagacccaggattattatctatcgcaactcttactccaccttttctctccccttcaaaag

 3.03 Intr +  85309  85622  314  0  2   70   71   198 0.095  10.36
ctccctgggacagagcacctaggggaaggggcagctgtgggcgcagcttcagcagactta
aatgttctggcctgctggctctaaagagagcagcggatctcccagcacagtacttgagct
ctgctgagggacagactgcttcctcaagtgggtccctgaccccccgtgcctcctgactag
GAGACACTTCCCAGCAGGGGTCGACAGACACCTCATACGAGAGAGCTCCGGCTGGCAACT
GGTGGGTGCCACTCTGGGACGAAGCTTCCAGAGGAAGGAACAGGCAGCAATCTTTGCTGT
TCTCCAGCCTCTGCTGGTGTTAACCCAGGCAAATGGTCTGAAGTAGACCTCCAGCAAACT
CCAGCAGACCTGCAGCAGAGGTGCCTGACTGTTAAAAGGAAAACTAACAAACAGAAAGGA
ATAGCATCAACATCAACAAAAAGGATGTCTGCACCAAAACCCCATCCAAAGGTCACCAGC
ATCAAAGACCAAAG
gtagataaatccatgaagatgaggaaaaaccagtgcaaaaaggctgaaaattccaaaaac
cagaatgcctcttctcctccaaaggatcacaactcctctccagcaagggaacataactgg
atggagaatgagtttgacaaattgacagaaataggcttcagaaggtgggtaataacaaac

 3.04 Intr + 123040 123223  184  1  1   83   75   155 0.687  12.57
ctgaatttagttgcaagaggaatctttcgcttttatttttttaaactgctgatgagcact
cgattgaaatgactcagctttcatctgtggtttctcttccctaatagaataaagcatatg
taataacctgaaatactggacagcttgaacttctttaatgcccctgaatgtctcttacag
CCTTTGTCTAGGTTTGAACTTTCCAAATTATGTATTTCAGACGTTGAGAAAGAAGGGCCT
TAATGGCTGTGACAGCCCAGACCCCGATGCGGACGATTCCGTAGGTCACAGCCCTGAGTC
TGAGGACAAGTACAGGAAAATTAACGAAGATATTGATCTAATGATCAGCAGGCAAAGATT
GTGT
gtaagtactcagaacacccttcattttttttactcttgatatttctctgaacctggcagg
cattgaacaagaaagaaaacaaaggctgtgaaagccccgatcccgactcctcttatgcac
tcaccccacgcactgaagaaaaatacaaaaaaattaatgaagaatttgataatatgatca

 3.05 Intr + 123283 123420  138  0  0   60   95   104 0.979   8.04
tggctgtgacagcccagaccccgatgcggacgattccgtaggtcacagccctgagtctga
ggacaagtacaggaaaattaacgaagatattgatctaatgatcagcaggcaaagattgtg
tgtaagtactcagaacacccttcattttttttactcttgatatttctctgaacctggcag
GCATTGAACAAGAAAGAAAACAAAGGCTGTGAAAGCCCCGATCCCGACTCCTCTTATGCA
CTCACCCCACGCACTGAAGAAAAATACAAAAAAATTAATGAAGAATTTGATAATATGATC
AAGAGTCATAAAATTCCT
gtaagtaccaaaggtagatggctggtctgctgataactgctgcagtaacataccttaacc
ctctcagtgatggctttctctaagactcttcggaaagtcaaacagataaatagccatctc
atcccacgggcagctcatttagaaagcaaaccctaaaggatgctgagattatgtaatcta

 3.06 Intr + 132365 132542  178  1  1  118   92    35 0.641   5.47
agcacatttaagaaatcaatttatgatctgaacgtcttgagagctcttcttaatggtctt
ctagacacaaagtagtttggaatgtagaatttttcttggaaaaataagggctgtctgtct
tgaagagcttctgttattaattcttttcttttacctttgttttgttttctgttcctgcag
GCTGTTCCACCTCCCAACTTCGAGATGCCAGTCTCCATCCCAGTGTCCAGCCACAACAGT
TTGGTGTACAGCAACCCTGTCAGCTCACTGGGAAACCCCAACCTATTGCCACTGGCTCAC
CCTTCTCTGCAGAGGAATAGTATGTCTCCTGGTGTAACACATCGACCTCCAAGTGCAG
gtaacacaggtatgtcctcataaggatgtaatgctaacaaatagttggaaggaaccattt
tcggcaaagccaacactgctttatctacgagatgttttctggttttccacttactctcct
tcatggcttaccatccacccccgagctaggtctcctgcatgatagagcctaaattcttta

 3.07 Intr + 135291 135338   48  1  0  124  115    52 0.997   9.23
tttttaacgtttgagcacagcatggcacaataaaacaaatgtcagccatctgacttgggt
tgtactttacaagtttatgactattgcaagaggacaaaatactgaggttgctgaaggtaa
agtgttttgttctgtgggcctttagcctttctcgttttgatcttcctctttaatccatag
GTGGTCTGATGGGTGGAGACCTCACGTCTGGTGCAGGCACCAGTGCAG
gtaagcccagactccatactgcagtatgtatcattgttctgagttcttctactaggtgat
ttgcaggacaaagtcttttgaacaaataaagttaagagatctgtgagaggcatggaaaaa
tgacaccaagaatttttaaagcacttttctgaagcaggagtggttaaatagtaacttaga

 3.08 Intr + 152507 152679  173  0  2  103   35   162 0.928  11.14
agaggactattgaatacttaattgggttacttgtcccatggaggtcaaatcagtcatcct
atggttttgcaatgtacgtcttaccattaagcttttgtttttattctcatgttgtgtatt
cttcggaaacgtatttgacctagatttcttcctaaatgctttattgttttttgttaacag
GGAACGGGTATGGCAATCCCCGAAACTCACCAGGTCTGCTGGTCTCACCTGGTAACTTGA
ACAAGAATATGCAAGCAAAATCTCCTCCCCCAATGAATTTAGGAATGAATAACCGTAAAC
CAGATCTCCGAGTTCTTATTCCACCAGGCAGCAAGAATACGATGCCATCAGTG
gtaatacaaaactacattttaaataaatattgataatgttttgtatatgttttgctgttt
ttatatttgtctaacttgatgaattacttaacattctcccagaaaattaacataacagtg
ccattgacagagccttgcttgtatttagctattatttctggtaactggtttgcatttccc

 3.09 Intr + 154174 154197   24  0  0   62  111    46 0.571   1.60
acagctcattaagggaaacaaagaatgtctttgtaaggagttatctttggagtctgggtt
ttaaaactgtttaaactgttgtgtctatcggaagatgcttttccttttgttgaaaagatt
ttgcccaattataaatatttacggacactaattaataaaactccttccgcatgctctcag
TCTGAGGATGTCGACCTGCTTTTG
gtaagtggtgagagcgcttccctcaaatggcatgtgcaaagctacttttaggtagaggtg
gtagctttgataaaattggaagatattggaagttaccacagtatgtcaacattgattatg
tttaaataccattaatttctggcatcactcacaggtgaaaagaatgtcaggttttttttt

 3.10 Intr + 155061 155190  130  2  1   44  117    13 0.793  -0.85
tggtctcttgaaggattgtaaatgatagggttggcagagttcatagagacacatgttaaa
tgattaatttcatgagatttgtaccaagttatctctttatgtggaaaactaatactgaaa
tctaatatttttaacttttaaaaaaattcatcagtaatgtctttttatttattttaaaag
AATCAAAGGATAAATAACTCCCAGTCGGCTCAGTCATTGGCTACCCCAGTGGTTTCCGTA
GCAACTCCTACTTTACCAGGACAAGGAATGGGAGGATATCCATCAGCCATTTCAACAACA
TATGGTACCG
gtgagtagctttgtcatgtgcaattagtacactaaatactttttattgaaaatcaagatg
aaaaagttatcttttactctattaggaagctttatttagggcctgcgccgtccacagcac
tgcagcattacccattcttcactaagacaaagtgaatatccacatttttctttcttaact

 3.11 Intr + 155780 155915  136  0  1   56   86    88 0.951   4.11
tattccttttaaattagaattatcgctgatgctttatctcccctcccctcaaaattaaaa
atatctataataacgataatcctaatagaatattttggaaattgaaaatgtttattctat
ttaccatttgataatttctaaatttaatattttcccttgttgttttattctttaatctag
AGTACTCTCTGAGTAGTGCAGACCTGTCATCTCTGTCTGGGTTTAACACCGCCAGCGCTC
TTCACCTTGGTTCAGTAACTGGCTGGCAACAGCAACACCTACATAACATGCCACCATCTG
CCCTCAGTCAGTTGGG
gtaagcaatattattttttataatataattttagaatgtattttgaaaaacaaatgacag
tctctaaatatgtgcttcaatatcccattaacgggtataaaactctactttattgaaatc
caagtgtaattttcagatcaatacttttcaagtagcttaaatcttatatacctgtttttt

 3.12 Term + 161483 161804  322  2  1  120   43   176 0.950   9.61
aaaggcatcctaaatcgccctgagaaggcgatgcccttatgtgcttccaagcacgttttc
ttcactctgggcatgctctggtgtctatgcgagtctttaagctgatgtttgatttaattg
tgagttcctggggcctccaggcctccttcatctgtaactgggtttcctttcctcctacag
AGCTTGCACTAGCACTCATTTATCTCAGAGTTCAAATCTCTCCCTGCCTTCTACTCAAAG
CCTCAACATCAAGTCAGAACCTGTTTCTCCTCCTAGAGACCGTACCACCACCCCTTCGAG
ATACCCACAACACACGCGCCACGAGGCGGGGAGATCTCCTGTTGACAGCTTGAGCAGCTG
TAGCAGTTCGTACGACGGGAGCGACCGAGAGGATCACCGGAACGAATTCCACTCCCCCAT
TGGACTCACCAGACCTTCGCCGGACGAAAGGGAAAGTCCCTCAGTCAAGCGCATGCGACT
TTCTGAAGGATGGGCAACATGA
tcagattattacttactagtttttttttttttcttgcagtgtgtgtgtgtgctatacctt
aatggggaaggggggtcgatatgcattatatgtgccgtgtgtggaaaaaaaaaaagtcag
gtactctgttttgtaaaagtacttttaaattgcctcagtgatacagtataaagataaaca

Predicted peptide sequence(s):


>MEF2C_1|GENSCAN_predicted_peptide_1|209_aa
MHLEKPQTLNASLRKQPGLGGWGAIPCKATGAELSKAMGAHLLHQHDLDVRHRVKDQCPQ
LFQDMALGCDEPHQFLKCKEQPEDVWVYACAQVSVTASRASRELETMCACVRAREGSARE
GGGAGPRIRARRGRSEEEEEEEEGGGREGGGGGGGESGSQRPVGLKVTRLVQKTASRKEV
TEDEWEKENSSQRLKHRVKKTGGGGGGGD

>MEF2C_1|GENSCAN_predicted_peptide_2|89_aa
MNITNNERLTATVISSRVNGAYNCCCQQLLQIAKRPQKQFRKEKFLNGSTLWKKLFLYSH
CSFPALKYDVEATPTQCKDEDEDLNDDPL

>MEF2C_1|GENSCAN_predicted_peptide_3|634_aa
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVEETLPSRGRQTPHTRELRLATGGCHSGTKLPEEGT
GSNLCCSPASAGVNPGKWSEVDLQQTPADLQQRCLTVKRKTNKQKGIASTSTKRMSAPKP
HPKVTSIKDQSLCLGLNFPNYVFQTLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINE
DIDLMISRQRLCALNKKENKGCESPDPDSSYALTPRTEEKYKKINEEFDNMIKSHKIPAV
PPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGGL
MGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLI
PPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTY
GTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTSTHLSQSSN
LSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSPVDSLSSCSSSYDGSDREDH
RNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT