GENSCAN 1.0	Date run: 16-Jan-104	Time: 12:09:09

Sequence MAT2B_1 : 16103 bp : 38.08% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   7584   7778  195  2  0   85   80    92 0.933   6.79
gaattacaggcatgagcctgatgcccgaccctaacttaactttagaattggcttgcagat
atgggacatgagtcaaaatacgtagaattaagacatttagggaacaacgatggtgcctaa
tatatttgagagaactgttttcaaagttagtaactctttctatccgccttcaccttttag
GAGGAAGTTAACATCCCTAATAGGAGGGTTCTGGTTACTGGTGCCACTGGGCTTCTTGGC
AGAGCTGTACACAAAGAATTTCAGCAGAATAATTGGCATGCAGTTGGCTGTGGTTTCAGA
AGAGCAAGACCAAAATTTGAACAGGTTAATCTGTTGGATTCTAATGCAGTTCATCACATC
ATTCATGATTTTCAG
gtatgatttaggttattttaagatatacatgaacaatattaagagttgtctggatgatac
agaaactatccttgctctcaaggaaattactatgtttgaaagctctaaagttgtattatg
cagtagcatttttttcatttagcatgacatggtatatgtaaaccttaaagttaaattttg

 1.02 Intr +   9137   9251  115  1  1   42   95   115 0.977   6.70
tttgaaccttgcggggaaaagaagcagcatgacaaaactacattagaaattacaatgatt
tattcttagttgaaagaatgttgacttactgcacatttttctctgaattaactttaagaa
ggctgtaatacctctttcattttattttgagttaaaaatacgtcaatgcttaacttctag
CCCCATGTTATAGTACATTGTGCAGCAGAGAGAAGACCAGATGTTGTAGAAAATCAGCCA
GATGCTGCCTCTCAACTTAATGTGGATGCTTCTGGGAATTTAGCAAAGGAAGCAG
gtaatgatgactttataaaattttcataaaatattaagtgattgctgagtttttagaaat
taaggttttgtagatggttatttgtttttatatatcatgaaaaaccattctaaattccat
gaaagagtaatgtcatgtaaacatttaatagatttgtcttctttttttgtagctgctgtt

 1.03 Intr +   9424   9576  153  2  0   82   82   134 0.998  11.32
ggaagcaggtaatgatgactttataaaattttcataaaatattaagtgattgctgagttt
ttagaaattaaggttttgtagatggttatttgtttttatatatcatgaaaaaccattcta
aattccatgaaagagtaatgtcatgtaaacatttaatagatttgtcttctttttttgtag
CTGCTGTTGGAGCATTTCTCATCTACATTAGCTCAGATTATGTATTTGATGGAACAAATC
CACCTTACAGAGAGGAAGACATACCAGCTCCCCTAAATTTGTATGGCAAAACAAAATTAG
ATGGAGAAAAGGCTGTCCTGGAGAACAATCTAG
gtaagacctaatctatttagcccctgattgtttttgaagactttaaaaatcatttataca
tacacatatatatgttttaaatttaaaaagtcaatgaatatgaatcattagagaaaaatt
agaatatagttaataaagaaaataaaaaattctaagagataactactttgtgaatccttc

 1.04 Intr +  12100  12293  194  2  2  104   99   201 0.999  21.09
ctgtgcctggccttgaatatttttacattgcgttgtcacaagtgagctgtgtcattttgg
tatattttaattaaaaggcaaggtttctactttgatattatttaaatccacacccttgta
tcttacatcaaaatttaagaatcagtcagctttaaattatttgcttttattcttctctag
GAGCTGCTGTTTTGAGGATTCCTATTCTGTATGGGGAAGTTGAAAAGCTCGAAGAAAGTG
CTGTGACTGTTATGTTTGATAAAGTGCAGTTCAGCAACAAGTCAGCAAACATGGATCACT
GGCAGCAGAGGTTCCCCACACATGTCAAAGATGTGGCCACTGTGTGCCGGCAGCTAGCAG
AGAAGAGAATGCTG
gtaagaaggattcctgagtcctgtcttagcgaaggtccgctttgtcttttccatgcttga
actttcacagctgtacttggagtgttactgagtgaaagccaaaagtgcttttttaaaact
aggagaccaaacaaaagtagtttacatatacactgtattcatgaagaataaaaatattat

 1.05 Intr +  13143  13256  114  2  0   68   95    30 0.725   1.42
aagtgttttgctaagagtattagtaggaatttgattttagatatcttgtggagacctttc
cagaaaaagagggttgccttttagttcctggaccttattttaagtaagctttttggtcaa
acctattctactcagctcaaaaagttgaaactattgaatttattgtgtcatcgttcttag
GATCCATCAATTAAGGGAACCTTTCACTGGTCTGGCAATGAACAGATGACTAAGTATGAA
ATGGCATGTGCAATTGCAGATGCCTTCAACCTCCCCAGCAGTCACTTAAGACCT
gtaagtacatggctgtaaaaacctttagatccattgctatggtatatattattgctgtgt
tgggtaacttcatttctcagtactaatcaaagtgaactttgcttgtatgctggctgttca
tagtgctacttttctctaaattatcatctgtagagaagatcatgagtattgaagtttgta

 1.06 Term +  13775  13945  171  1  0   80   29   169 0.999   7.04
gaggctgacgcaggaggatcccttgagcccaggaatttgagactagcctgggcaatggag
ggagatctcatctctgtttaaaaatatatacatatttaaaaaaaggtcagggggaacaaa
gccctcaaaatatagcctttcacttacttttgatttttttgtgtttatctttctttaaag
ATTACTGACAGCCCTGTCCTAGGAGCACAACGTCCGAGAAATGCTCAGCTTGACTGCTCC
AAATTGGAGACCTTGGGCATTGGCCAACGAACACCATTTCGAATTGGAATCAAAGAATCA
CTTTGGCCTTTCCTCATTGACAAGAGATGGAGACAAACGGTCTTTCATTAG
tttatttgtgttgggttcttttttttttttaaatgaaaagtatagtatgtggcacttttt
aaagaacaaaggaaatagttttgtatgagtactttaattgtgactcttaggatctttcag
gtaaatgatgctcttgcactagtgaaattgtctaaagaaactaaagggcagtcatgccct

Predicted peptide sequence(s):


>MAT2B_1|GENSCAN_predicted_peptide_1|313_aa
EEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHI
IHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFD
GTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMF
DKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEM
ACAIADAFNLPSSHLRPITDSPVLGAQRPRNAQLDCSKLETLGIGQRTPFRIGIKESLWP
FLIDKRWRQTVFH