GENSCAN 1.0	Date run: 16-Jan-104	Time: 11:40:12

Sequence LHFPL2_1 : 27457 bp : 44.18% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1276   1705  430  0  1   38  110   626 0.810  54.22
gccgcaggcggtgctctgggtccgggagcgctgtccccagcatgaacgcggccggcggcg
ggagtgaatgactgcagctgcgacttccttcccgggccgcccgagcctccttccccaccg
actttcttgttttgattaactccgtggactcctgactctttcttcgcccggaacatcaat
ATGTGTCATGTCATTGTCACCTGTCGCTCGATGCTCTGGACCTTGCTGAGTATTGTGGTG
GCTTTTGCCGAGCTCATTGCCTTCATGAGTGCAGACTGGCTGATCGGGAAAGCGAGGAGC
CGCGGCGGCGTGGAGCCGGCGGGCCCGGGCGGGGGCTCCCCGGAGCCCTACCACCCCACC
CTGGGCATCTACGCCCGCTGCATCCGGAACCCAGGGGTGCAGCACTTCCAGCGGGACACG
CTGTGCGGGCCCTACGCCGAGAGCTTCGGCGAGATCGCCAGCGGCTTCTGGCAGGCCACA
GCTATTTTCCTGGCTGTGGGAATCTTTATTCTCTGCATGGTGGCCTTGGTGTCCGTCTTC
ACCATGTGTGTACAGAGCATCATGAAGAAAAGCATCTTCAATGTCTGTGGGCTGTTGCAA
GGAATTGCAG
gtaagaaggcaggaccccgggcacggtgggatggagggatggagagctgccggtgcagcg
cactctggtactgggcattcgcttcctgctagttttggagaagaccactttctgtctatt
caggtttcctttgccccttccgttctaggcgacgtttgtgtgctgctcgcatgggtctct

 1.02 Intr +   5043   5072   30  1  0  102   81    37 0.300   2.50
gggcagctgtggttcttgaatctgtggctgaggacattgccatactggcatctgaaaggg
ctggcttgctttctcccgttggccaatctgtgatagcctctggtcagccccagcctcagc
aaggacttgctgcagctgggagcatctgccttttctctccctatgccccctctccctcag
CCCTGGATCTCTTCAACACTGAAACAAATG
gtgagaaaggaggctgttgccagagcaacaaaaggattctttagaaatacactcaggctg
tgtttgttcttacaacttacattttggcaaaaatgtgactggatgagaaatgatcgtaag
catattcttttgctacacctaattttaagatataaataggccacaggcttgtgtagcctt

 1.03 Term +  22336  22592  257  2  2  127   29   147 0.765   8.45
tctaataatgtgatacttcttgatcaggtcagattagtttgcatgaaacagtcccaacac
tttctattgcagaatagatgcccttgcccaaagcaagcaaatcaagtaacaattacaaca
gatctggacagttgtagcaccatggggattttctaatctgttttctcttttgttctgcag
GTCTATTCCTTATCCTCGGTTTGATACTCTACCCTGCTGGCTGGGGTTGCCAGAAGGCCA
TAGACTACTGTGGACATTATGCATCTGCCTACAAACCTGGAGACTGCTCCTTGGGCTGGG
CCTTTTATACCGCCATTGGGGGCACAGTCCTCACTTTCATCTGTGCTGTCTTCTCTGCAC
AAGCAGAAATTGCAACCTCTAGTGACAAAGTACAGGAAGAAATTGAAGAGGGGAAAAATC
TGATCTGCCTCCTTTAG
tttggaagagacaatgccattttctcccttgagtaatcttgtgaaacagtccacagtttc
atcatttgagtcaagtggagaactaacctttacctaccaaagccacgttccacggcccga
ggcttaaacaggaccaatgagaggccacatccagctacgcaaagttactggacatgcggt

Predicted peptide sequence(s):


>LHFPL2_1|GENSCAN_predicted_peptide_1|238_aa
MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPT
LGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVF
TMCVQSIMKKSIFNVCGLLQGIAALDLFNTETNGLFLILGLILYPAGWGCQKAIDYCGHY
ASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLL