GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:48:57

Sequence KIF3A_1 : 40245 bp : 35.95% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1202   1475  274  1  1   58  115   210 0.957  16.89
ttttaataaacttttcagctatatgtaagatctttaattgcatttaacaaatacctgtga
agtgtttaatgtgtgcaaggcactgagttggaaaagtagccttttaaagtttataaattt
aatctgatgagggtaaaaattaatgttcttttcattatttgtaaatattatctccaacag
ATCAATAAATCAGAGAAGCCAGAAAGCTGCGATAATGTGAAGGTTGTTGTTAGGTGCCGG
CCCCTCAATGAGAGAGAGAAATCAATGTGCTACAAACAGGCTGTCAGTGTGGATGAGATG
AGGGGAACTATCACTGTACATAAGACTGATTCTTCCAATGAACCTCCAAAGACATTTACT
TTTGATACTGTTTTTGGACCAGAGAGTAAACAACTTGATGTTTATAACTTAACTGCAAGA
CCTATTATTGATTCTGTACTTGAAGGCTACAATG
gtaagtgaatctttactttttaaaaaactcccttattgagacataattactgtgccataa
attcacatattgcagctgtgcagtttgatgagtgtagtaaatatatacagttgtgaaacc
atcatcacaatccagctttagaacacccttgtcatcctcaaaatttcctttatgcccatt

 1.02 Intr +   9182   9326  145  0  1   92   93   136 0.999  12.92
ttgtgcttgtggtacagagtacgcattgtaattgttgataataaaggtgaaacttgtgct
agaataaattttgaatccaggggagaaattacatcacagtgtcaaaggaattaattttaa
gagctattgttctgtagcattagactttaagaagtaactgattctcttcatcattttcag
GGACTATTTTTGCATATGGACAAACCGGAACAGGCAAAACTTTTACCATGGAAGGTGTTC
GAGCTATTCCTGAACTTAGAGGAATAATTCCCAATTCATTTGCTCACATATTTGGTCATA
TTGCAAAAGCGGAGGGTGATACAAG
gtaaaagggaattcttttattttctgatattgagaagtacaaacactggaaaggcacata
ggtataaattttataaacatattttaaaaccgttcttatgaatatttcactctttgactt
tttaaaaatgatgttttatagatttttggttcgagtgtcttatttggaaatatataatga

 1.03 Intr +   9468   9552   85  0  1   45   94    71 0.985   2.30
catatttggtcatattgcaaaagcggagggtgatacaaggtaaaagggaattcttttatt
ttctgatattgagaagtacaaacactggaaaggcacataggtataaattttataaacata
ttttaaaaccgttcttatgaatatttcactctttgactttttaaaaatgatgttttatag
ATTTTTGGTTCGAGTGTCTTATTTGGAAATATATAATGAAGAAGTTCGTGACCTTTTGGG
CAAGGATCAGACACAAAGGTTAGAG
gtaaggataattgaaattggtggagtactttttccaaagcaatagaatatttgctaaatt
aaggtcccccttctttttttaaacaaaagttgctttttatattttaaataatctcgtaca
tatataatgtcgtacatctgcagacatatctggggataaattactgaagcaggattgctg

 1.04 Intr +  14966  15071  106  1  1   54   97   107 0.995   7.07
ttttatgtgtaattcttcatttgtatgttcttcctatagacatctccatgcgtgtaggaa
cagtgtctatcttatcagtatattccctctgtctagtagagtgtccaacacataggagat
actcaataaataattgtggaagagttattgatatagtataaagtcttaatttttttttag
GTTAAAGAAAGACCTGATGTGGGAGTTTATATCAAAGATTTATCAGCTTATGTGGTAAAT
AATGCTGATGATATGGATAGAATTATGACGCTAGGCCACAAAAATC
gtaagtatagtgtgtaattgtgattaagcatctgtgtgttgagtaggctggtttagaagc
aaatttggtatggcactttaccctgtagagactggattttttaggtttcttgaaaaccat
tccactttgattatttaccatgtagagagcatagatgaatgaaagataccacaaatcatt

 1.05 Intr +  18675  18835  161  1  2   53   87   113 0.669   6.49
aaccttacaaatttgttatcaacaaagtataagagaaatttcatgtagtggctaagtaca
cacccatgcctttatggtttagccatgctctctggcttttgattgtgataaaattaagtg
ttttaaactgttcaggatgtttaattatttttaaaggcactctctgttacacttttaaag
GATTTCGTTTATTTATTAAAGGTTCTGTTGGTGCAACTAATATGAACGAACATAGTTCCC
GTTCCCATGCCATCTTTACAATTACTATAGAATGCAGTGAAAAAGGCATTGATGGTAACA
TGCATGTCAGGATGGGGAAGCTCCATCTTGTAGATCTTGCT
gtaagtaacaggacactgcttaaggaataactctttcttgtgatccatttattttataaa
tgaatgaaaattaaagtgaaaaggtatgatttacatatgatttttaaggtgttacttgtg
tatgtttattatttattatggaacatttcaaatgtatatgaaagtagatagaatagtata

 1.06 Intr +  19238  19435  198  1  0   49   95   170 0.998  12.43
tcatggctaatcttgtttcatgtactctcccccacttcttcctttcctatattattttga
agtgaattcaggcatcatatcaggttttttactgttacattactttttaataaaaccttg
ggaagaatattctatttttaaaaaaattttagctttactttcatctctgtttattgctag
GGTTCAGAAAGACAGGCAAAAACTGGAGCTACTGGACAGCGCCTAAAGGAAGCTACAAAA
ATCAATCTTTCACTTTCCACCCTTGGTAATGTAATTTCTGCCTTGGTTGATGGAAAAAGC
ACTCATGTGCCTTATCGTAACTCTAAACTGACTCGTCTTCTTCAGGATTCCTTAGGAGGA
AATTCAAAAACCATGATG
gtaagacttaattggtgatatagttaacatcaggcaaatttaagattgtaatttatgcca
ataattgatacgtatcacattttttaaacttgattattttactttttttgacttgtggtt
gtcctttttgtggtacactcgtgtattagcccataatagtgtcctttggaaactcatgtg

 1.07 Intr +  19749  19923  175  2  1   35   65   256 0.999  16.59
tacactcgtgtattagcccataatagtgtcctttggaaactcatgtggttgacactctca
ttttcgagaaggccaagggtgcatatgtgctttaaatgtttttgatgtatttgtaatggt
agtattaattttaactctgtcaagtgtaaaatgatttgtttcatatttctaattcaatag
TGTGCAAATATTGGGCCAGCAGATTACAATTATGATGAAACTATCAGTACATTACGGTAT
GCCAATCGTGCTAAGAATATTAAAAATAAAGCTAGAATTAATGAAGATCCAAAGGATGCT
TTGCTGCGTCAGTTCCAGAAAGAAATAGAAGAACTGAAAAAGAAGCTTGAAGAAG
gtagcttttcctcaaaatattaatctttatgttggctaaaaatacattgttgaaccacta
actgttctaacaaaagccctctattaaaccttttttgagcctctaacattggtagttaaa
tgaatatttctagaaagtgacttggtacttacatactttcgcattttcatattaagctta

 1.08 Intr +  24623  24721   99  0  0   40   98   149 0.995  10.26
gatatctcatctgtgtctgagattggcatatctgttatactttctaggagcatttaaata
gtatttaaatttgttgtttgcagtaacaaaaatctgaggaagaaagctgatataggtatt
tcctaaatagctaatgacttcgtacaggataaaaaacattgtattaaatttctgtccaag
GAGAAGAAATATCAGGCTCTGATATCAGTGGGTCAGAGGAAGATGATGATGAAGAGGGTG
AGGTTGGAGAAGATGGAGAGAAAAGGAAAAAAAGAAGGG
gtaagttctgtttagtaatctgatttgtagaaattaggtggtttcacaaggtggtagagt
gcatgacttttattttgccgttatctgtttaatatattagataacaattagaacagaaga
tgtatgccatttacctggttaactttgcattttttctcctgtattgatccgtttatagct

 1.09 Intr +  26702  26773   72  0  0  100   75    58 0.593   4.16
gaatattggataaactaccaagattggtttttaggaaagtaaattttggttctttaatac
aaagcttgattgtcctttaaaatttttttctctgaaaactgaatttttctctgtgtgtgt
gttcattttcttgtttcctctttctttggttcctgttgggctcatttctttgttttccag
GCAGTAGCAGCAGCAGTAGTTCAGACTCCACATGTTCTGTCATAGAGAAACCTCTGGATA
AGTTCTTGCCTA
gtgagtggtagctcttacattctctaacagagctttggcttttccataacccatgggctt
catttgagcaatgctgcaccactccctgtcattacctaaagaatacatgttggattcctc
agtagaacaaagcatgtgatgattcctccaccccctttcattgcttccagttaatcataa

 1.10 Intr +  32061  32217  157  1  1    3   81   251 0.301  14.05
agttctaggagcataataaatggaaatgcatgatattattggtttgatttccttaaaata
ttgataattggttttgtattattgaggagtgtaggcatttctatattgaaggaggtaatt
tatataagtctgaaacattgattcattttagtgattgttgcaattaaatgattcaaatag
GAAAAAAGAAAGTCTCCCCAGACAAGATGATTGAAATGCAAGCAAAAATTGATGAGGAGA
GAAAAGCACTTGAAACAAAGCTCGACATGGAAGAAGAAGAAAGAAACAAGGCTAGAGCTG
AATTAGAGAAACGGGAAAAAGATCTTCTTAAAGCCCA
gtgagtattattgaattgagatgaattcatgatttaaatttctgttttttcctaggatat
ataaaataggaaaattgaatagtaattaaaagcttggatttttgtctccagtgtagctat
tttggatagaagggtccattgtatatagtgtatttctaaaaactagatctattttggtta

 1.11 Intr +  32615  32795  181  2  1   19   80   195 0.999  10.75
tagaatgagttataaattaagttagaaatcgatactacacagtggtgtaatttggcagag
atgttacataattatatttctattttgaaattgtatatccaaattttaaattttgggaaa
tgatattagtagaataatagatcatcagtgaatatagagtattctcattctaatcaacag
ACAAGAGCATCAGTCTTTGCTGGAAAAATTATCTGCCCTGGAAAAGAAGGTAATTGTTGG
TGGGGTTGACTTGTTGGCCAAAGCTGAGGAACAAGAGAAACTTCTTGAAGAATCTAACAT
GGAACTGGAAGAAAGGAGGAAAAGAGCAGAGCAACTTCGCAGAGAACTTGAGGAAAAAGA
G
gtaatgtgactttctgtttttagtttggtattttgccagagagatttaacttttctagtg
gaaagctaaatatctataatcgtattgaaattttaaagcatatttatggattgctttgaa
gatcagatttgctaaacatttatgtcatttgttaaagaattagatatttgattttacaaa

 1.12 Intr +  33012  33122  111  2  0   32   73    92 0.772   1.76
cagagagatttaacttttctagtggaaagctaaatatctataatcgtattgaaattttaa
agcatatttatggattgctttgaagatcagatttgctaaacatttatgtcatttgttaaa
gaattagatatttgattttacaaagaaatttattctgaagtttactaatttttgtcatag
CAAGAACGCTTGGATATTGAAGAAAAATATACCAGTTTGCAAGAGGAAGCACAGGGAAAG
ACCAAGAAGTTAAAGAAAGTTTGGACTATGCTGATGGCTGCAAAGTCAGAG
gttggttctcttagaaattacctactaatgcagttctggattttttaaaagggagttctt
tgattaagaatttataaataatcataatgtgagcttataatttaaaagaaataaaatatt
tctttatgtgcaatttttaattttatctattagtctaaattgtttcttttcaaccttaac

 1.13 Intr +  33468  33593  126  2  0   52   98   129 0.976  10.26
cttttcaaccttaacaaatagtgtagaatagatgctgatagtgtcacgctgtttatcatt
tttataaaagaactaggtaagctctcacaaggtttcttagacaagcatcctatgtgagat
ggtgctgttttgtagttaaagtcttgtttgttcataatatttttatggattttctggtag
ATGGCTGATCTCCAACAAGAACATCAGAGGGAAATTGAAGGCCTACTGGAGAACATTCGG
CAACTTAGCCGGGAGCTTCGACTTCAGATGCTTATTATTGATAACTTTATACCTCGGGAT
TATCAG
gtaaaaaggaagttctctgaccgagatagtcgcttgactgggattaaggaacaaagattt
ctaatttaactgatgataaatacttaatacttcagttattgaatgtacaattttttgaac
aaatgccatcacatttcactttagttgttaacttttaatacataatctctgtttgagtat

 1.14 Intr +  36385  36509  125  0  2   60  116    90 0.602   7.46
accaacctttattaagtacattttagatactgggattagaagatgatgtcattagacatt
tctttggttttagcttctgtgggtttgatcaaggagtttattcagtattttaaatcttcc
cccaaatctggctttaactctttgccttaagagtgctttgtgtttgtttcttttacttag
CCCTTTGAGGTGGACCTTTCTCACGTGTATCTTGCCTATACTGAGGAGAGTCTGCGTCAG
TCTTTGATGAAACTAGAAAGACCACGAACTTCAAAGGGGAAAGCAAGGCCAAAGACAGGG
AGAAG
gtaaggactgtccttgaatctggtaaaacgaaggcattgaggtattctaattagatacat
gtacaggaagttaaaatttatttagttaaaacatgatacatattttggctgatttattaa
aaatcaaattcctggctgggcacagtggctcacgcctgtaatcccagcattttgggaggc

Predicted peptide sequence(s):


>KIF3A_1|GENSCAN_predicted_peptide_1|672_aa
INKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFT
FDTVFGPESKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGI
IPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIK
DLSAYVVNNADDMDRIMTLGHKNRFRLFIKGSVGATNMNEHSSRSHAIFTITIECSEKGI
DGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHV
PYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDP
KDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGSSSSS
SSDSTCSVIEKPLDKFLPRKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAEL
EKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRA
EQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREI
EGLLENIRQLSRELRLQMLIIDNFIPRDYQPFEVDLSHVYLAYTEESLRQSLMKLERPRT
SKGKARPKTGRX