GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:47:24

Sequence IL3_1 : 4949 bp : 52.56% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1254   1415  162  2  0   86  105   245 0.999  23.70
tggaggttccatgtcagataaagatccttccgacgcctgccccacaccaccacctccccc
cgccttgcccggggttgtgggcaccttgctgctgcacatataaggcgggaggctgttgcc
aactcttcagagccccacgaaggaccagaacaagacagagtgcctcctgccgatccaaac
ATGAGCCGCCTGCCCGTCCTGCTCCTGCTCCAACTCCTGGTCCGCCCCGGACTCCAAGCT
CCCATGACCCAGACAACGCCCTTGAAGACAAGCTGGGTTAACTGCTCTAACATGATCGAT
GAAATTATAACACACTTAAAGCAGCCACCTTTGCCTTTGCTG
gtgagtagcttggataagactggcctgcagcagtgaggggtggtggctgcctaaggccaa
aaggcctcatgggcctttctctcccttcacccccacaggacttcaacaacctcaatgggg
aagaccaagacattctgatggtaagagctcagcccgtggatcccgatccacttcctgcct

 1.02 Intr +   1514   1555   42  1  0  120   95    49 0.972   7.72
cttgaagacaagctgggttaactgctctaacatgatcgatgaaattataacacacttaaa
gcagccacctttgcctttgctggtgagtagcttggataagactggcctgcagcagtgagg
ggtggtggctgcctaaggccaaaaggcctcatgggcctttctctcccttcacccccacag
GACTTCAACAACCTCAATGGGGAAGACCAAGACATTCTGATG
gtaagagctcagcccgtggatcccgatccacttcctgcctgggtgacttcagccatgtca
ttccatcttacctagccttgctttcttcatctgtaaaatagggttaatagcacctatctc
agtgggattgttatgacaatcaaatggcacaatgtgcatgttctggcccagcatctggca

 1.03 Intr +   2859   2948   90  2  0   86   53    90 0.982   5.99
cactcacttctaggcctgtgcccttgggcagggacccacctgaggcaagaacgggactag
gagggaacccgaggatgtccccaacagtgggcttgggaaactgtgggggtgacttccacc
tgcttgtgggagggatactctgtaacctttcccccttaagtgtattctctgccccgttag
GAAAATAACCTTCGAAGGCCAAACCTGGAGGCATTCAACAGGGCTGTCAAGAGTTTACAG
AACGCATCAGCAATTGAGAGCATTCTTAAA
gtatgtgaagctgttgagggtttgggatccctgtgttggccctgccctgcctctggggag
gagagcagggcccactccctttccaagggaatctctgaccatctgctttggtctctttcc
acagaatctcctgccatgtctgcccctggccacggccgcacccacggtaagctgtccccc

 1.04 Intr +   3073   3114   42  0  0  113  115    19 0.982   6.02
tcaacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaagtat
gtgaagctgttgagggtttgggatccctgtgttggccctgccctgcctctggggaggaga
gcagggcccactccctttccaagggaatctctgaccatctgctttggtctctttccacag
AATCTCCTGCCATGTCTGCCCCTGGCCACGGCCGCACCCACG
gtaagctgtcccccaagatgcccgtcatggcttgctcctcagctggtcatcaccattaca
gcctggactcacctaatgccaccttcttggtttctttatagcgacatccaatccatatca
aggacggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgaga

 1.05 Term +   3216   3338  123  2  0   96   47    85 0.649   3.89
ggaatctctgaccatctgctttggtctctttccacagaatctcctgccatgtctgcccct
ggccacggccgcacccacggtaagctgtcccccaagatgcccgtcatggcttgctcctca
gctggtcatcaccattacagcctggactcacctaatgccaccttcttggtttctttatag
CGACATCCAATCCATATCAAGGACGGTGACTGGAATGAATTCCGGAGGAAACTGACGTTC
TATCTGAAAACCCTTGAGAATGCGCAGGCTCAACAGACGACTTTGAGCCTCGCGATCTTT
TGA
gtccaacgtccagctcgttctctgggccttctcaccacagagcctcgggacatcaaaaac
agcagaacttctgaaacctctgggtcatctctcacacattccaggaccagaagcatttca
ccttttcctgcggcatcagatgaattgttaattatctaatttctgaaatgtgcagctccc

Predicted peptide sequence(s):


>IL3_1|GENSCAN_predicted_peptide_1|152_aa
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF