GENSCAN 1.0	Date run: 16-Jan-104	Time: 12:23:57

Sequence F12_1 : 9836 bp : 55.70% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1250   1306   57  1  0   95  109   127 0.942  14.76
ctcccaactttccggccctcaaggggtgaccaaggaagttgctccacttggctttccaca
aacagcctgtgccccaccaggctcaggagggcagcttgaccaatctctatttccaagacc
tttggccagtcctattgatctggactcctggataggcagctggaccaacggacggacgcc
ATGAGGGCTCTGCTGCTCCTGGGGTTCCTGCTGGTGAGCTTGGAGTCAACACTTTCG
gtgagtgctgtgggaaccaggattgtcccaggattgttctggggggtcgctatcacagcc
atgagccatggcctctgctcatgacctgtgggtccaggtgactaggaggcctatgtggaa
aggtgaggccagcccggaaggcccaggcagaggagacagacaaccagaccgggtggatac

 1.02 Intr +   1674   1731   58  2  1  117  123    49 0.999  10.25
cagcctgcatttctgggggagatgggccttaagaagacaacggggggaggtagaaagggt
ttgggtcttgggaagaaatctctgcatttctgggctgtgagaggaagctgcagactagca
acagatcggtggcaggctatgacttatagtcagttccctgccttcttctctcccttgtag
ATTCCACCTTGGGAAGCCCCCAAGGAGCATAAGTACAAAGCTGAAGAGCACACAGTCG
gtaagtggcctggctcctcctcccgggaacccttgggtggggatgtgtatggtgcagtgt
gtgcagtctcagggcagtctagtctagtgcctacctggtgctaggtcttatgcccatggg
cactagagtgatcgtgagctgtgtgatccttgagggcagggtatgggctgtgtctaagtg

 1.03 Intr +   4717   4816  100  2  1   55   99   122 0.990   9.67
gctgggattacaggcttgagccaccgcgcccggccctgaacccaacttttagagcagaaa
gtgttttcaatgcacagcgacctttttgagggtctgtccttttcctgaccagaccctgag
ggacagtgcctgagcagttgagtacaggggaagtcctcagagagtgtgttgtccctgcag
TTCTCACTGTCACCGGGGAGCCCTGCCACTTCCCCTTCCAGTACCACCGGCAGCTGTACC
ACAAATGTACCCACAAGGGCCGGCCAGGCCCTCAGCCCTG
gtaagactacgcagaggagttggagcaggggcctgggagacatgtaccctgcctgtcctt
ctgtccaaggaactctgcttggagagaggggactgtgatagggcagggtgggccaggccc
ctgggtagagcagggaagccttgtctctttctacaggtgtgctaccacccccaactttga

 1.04 Intr +   4973   5043   71  2  2   71   43    57 0.796  -1.18
gggccggccaggccctcagccctggtaagactacgcagaggagttggagcaggggcctgg
gagacatgtaccctgcctgtccttctgtccaaggaactctgcttggagagaggggactgt
gatagggcagggtgggccaggcccctgggtagagcagggaagccttgtctctttctacag
GTGTGCTACCACCCCCAACTTTGATCAGGACCAGCGATGGGGATACTGTTTGGAGCCCAA
GAAAGTGAAAG
gtgctacacacagcctctggggtggcctggggctctctcctcccgcctcattactctcct
ggtatcaccagaccccacacacctgggattctggacccagccccttctctccctccacaa
taccctttggaagtccagagggagagttctgggaaggagtggtcccattttgcaggtggg

 1.05 Intr +   5345   5455  111  0  0   90  100   -20 0.540   0.25
accctttggaagtccagagggagagttctgggaaggagtggtcccattttgcaggtgggt
aaaccaagcttggaaacttggagtagcaaggtcacaaggcaagtaggttcaagaagggcc
ttggcccccagctgtgtgactcagctccctgctcttccttccaccatgtccatctctcag
ACCACTGCAGCAAACACAGCCCCTGCCAGAAAGGAGGGACCTGTGTGAACATGCCAAGCG
GCCCCCACTGTCTCTGTCCACAACACCTCACTGGAAACCACTGCCAGAAAG
gtgaggagatgtggaggacctgggcggggtgctgggggacaggggcaaccctgggcctac
agaataggttgctggatactcggagacttggcatggtcctagactctcctgagaccacta
tccctctttgtccccagagaagtgctttgagcctcagcttctccggtttttccacaagaa

 1.06 Intr +   5593   5724  132  2  0  107   84   129 0.999  15.52
tgtctctgtccacaacacctcactggaaaccactgccagaaaggtgaggagatgtggagg
acctgggcggggtgctgggggacaggggcaaccctgggcctacagaataggttgctggat
actcggagacttggcatggtcctagactctcctgagaccactatccctctttgtccccag
AGAAGTGCTTTGAGCCTCAGCTTCTCCGGTTTTTCCACAAGAATGAGATATGGTATAGAA
CTGAGCAAGCAGCTGTGGCCAGATGCCAGTGCAAGGGTCCTGATGCCCACTGCCAGCGGC
TGGCCAGCCAGG
gtgagcagatggttgggaacggaccagggaggagcgtcaggaagacaggctggcaggagg
ccgggtggtgtgccgggaaggagagctctctgggggggtctttaggcccaggggtggctc
actgcgttccctccccaagcctgccgcaccaacccgtgcctccatgggggtcgctgccta

 1.07 Intr +   5864   5968  105  0  0   51   92   137 0.998  11.09
caagggtcctgatgcccactgccagcggctggccagccagggtgagcagatggttgggaa
cggaccagggaggagcgtcaggaagacaggctggcaggaggccgggtggtgtgccgggaa
ggagagctctctgggggggtctttaggcccaggggtggctcactgcgttccctccccaag
CCTGCCGCACCAACCCGTGCCTCCATGGGGGTCGCTGCCTAGAGGTGGAGGGCCACCGCC
TGTGCCACTGCCCGGTGGGCTACACCGGACCCTTCTGCGACGTGG
gtgagtgagggtctggggcaagcagaaggccagcccccaggtgggacgggcttgccagga
aggaggagggagagtgcggaaagcagatgagagggaggcaggagagcccagccttggctg
cccagggagccccctttctcctcagacaccaaggcaagctgctatgatggccgcgggctc

 1.08 Intr +   6114   6279  166  1  1   89   78   196 0.987  18.23
cccggtgggctacaccggacccttctgcgacgtgggtgagtgagggtctggggcaagcag
aaggccagcccccaggtgggacgggcttgccaggaaggaggagggagagtgcggaaagca
gatgagagggaggcaggagagcccagccttggctgcccagggagccccctttctcctcag
ACACCAAGGCAAGCTGCTATGATGGCCGCGGGCTCAGCTACCGCGGCCTGGCCAGGACCA
CGCTCTCGGGTGCGCCCTGTCAGCCGTGGGCCTCGGAGGCCACCTACCGGAACGTGACTG
CCGAGCAAGCGCGGAACTGGGGACTGGGCGGCCACGCCTTCTGCCG
gtgcgccgcgtggggctgggtgacccctccgccccagggctccgggctcccggcgctcta
acggcgccccgtcgtgtggctacaggaacccggacaacgacatccgcccgtggtgcttcg
tgctgaaccgcgaccggctgagctgggagtactgcgacctggcacagtgccagaccccaa

 1.09 Intr +   6317   6582  266  2  2   53   50   269 0.711  17.29
ggccgcgggctcagctaccgcggcctggccaggaccacgctctcgggtgcgccctgtcag
ccgtgggcctcggaggccacctaccggaacgtgactgccgagcaagcgcggaactgggga
ctgggcggccacgccttctgccggtgcgccgcgtggggctgggtgacccctccgccccag
GGCTCCGGGCTCCCGGCGCTCTAACGGCGCCCCGTCGTGTGGCTACAGGAACCCGGACAA
CGACATCCGCCCGTGGTGCTTCGTGCTGAACCGCGACCGGCTGAGCTGGGAGTACTGCGA
CCTGGCACAGTGCCAGACCCCAACCCAGGCGGCGCCTCCGACCCCGGTGTCCCCTAGGCT
TCATGTCCCACTCATGCCCGCGCAGCCGGCACCGCCGAAGCCTCAGCCCACGACCCGGAC
CCCGCCTCAGTCCCAGACCCCGGGAG
gttaggaagtggggggggaaggaggagccgagagggcgccgggcgagctagattccggcc
agccggccgcgggctccccgtcctcagcccctgctcctccacagccttgccggcgaagcg
ggagcagccgccttccctgaccaggaacggcccactgagctgcgggcagcggctccgcaa

 1.10 Intr +   6687   6922  236  1  2   94  -14   395 0.683  27.84
ctcatgcccgcgcagccggcaccgccgaagcctcagcccacgacccggaccccgcctcag
tcccagaccccgggaggttaggaagtggggggggaaggaggagccgagagggcgccgggc
gagctagattccggccagccggccgcgggctccccgtcctcagcccctgctcctccacag
CCTTGCCGGCGAAGCGGGAGCAGCCGCCTTCCCTGACCAGGAACGGCCCACTGAGCTGCG
GGCAGCGGCTCCGCAAGAGTCTGTCTTCGATGACCCGCGTCGTTGGCGGGCTGGTGGCGC
TACGCGGGGCGCACCCCTACATCGCCGCGCTGTACTGGGGCCACAGTTTCTGCGCCGGCA
GCCTCATCGCCCCCTGCTGGGTGCTGACGGCCGCTCACTGCCTGCAGGACCGGCGA
gtacccgcccgcccagagccgccccaggggccgcggctcctccgtctcccagcgcagctt
ccacgctgcacccgaacccgtgccctaccttctcccgccccacccttctttccacgcccc
tccggagctcccggggaggaagctggaacacgggattggggttcgggagcagggggcttc

 1.11 Intr +   6975   7296  322  2  1   78   65   232 0.625  15.88
ggctggtggcgctacgcggggcgcacccctacatcgccgcgctgtactggggccacagtt
tctgcgccggcagcctcatcgccccctgctgggtgctgacggccgctcactgcctgcagg
accggcgagtacccgcccgcccagagccgccccaggggccgcggctcctccgtctcccag
CGCAGCTTCCACGCTGCACCCGAACCCGTGCCCTACCTTCTCCCGCCCCACCCTTCTTTC
CACGCCCCTCCGGAGCTCCCGGGGAGGAAGCTGGAACACGGGATTGGGGTTCGGGAGCAG
GGGGCTTCCCCAGAACGCTTGTGGCCAGGTCTGAGAGCGCTGCCTCTCCCCTACCCCCCC
CGCAGGCCCGCACCCGAGGATCTGACGGTGGTGCTCGGCCAGGAACGCCGTAACCACAGC
TGTGAGCCGTGCCAGACGTTGGCCGTGCGCTCCTACCGCTTGCACGAGGCCTTCTCGCCC
GTCAGCTACCAGCACGACCTGG
gtgcgtgggggcgccccgcggggacgggaagagagcttggggccccggcgtccccgcctc
acgctcctctccgcccgggttagctctgttgcgccttcaggaggatgcggacggcagctg
cgcgctcctgtcgccttacgttcagccggtgtgcctgccaagcggcgccgcgcgaccctc

 1.12 Intr +   7380   7523  144  1  0   63   61   138 0.997   9.36
cgccgtaaccacagctgtgagccgtgccagacgttggccgtgcgctcctaccgcttgcac
gaggccttctcgcccgtcagctaccagcacgacctgggtgcgtgggggcgccccgcgggg
acgggaagagagcttggggccccggcgtccccgcctcacgctcctctccgcccgggttag
CTCTGTTGCGCCTTCAGGAGGATGCGGACGGCAGCTGCGCGCTCCTGTCGCCTTACGTTC
AGCCGGTGTGCCTGCCAAGCGGCGCCGCGCGACCCTCCGAGACCACGCTCTGCCAGGTGG
CCGGCTGGGGCCACCAGTTCGAGG
gtaggcacaactgctaggggcaggggtaggggaggagacctttgatcactgggttaggcg
gaagaagcccgcgactttggtatcgttccgggtgcctacagaatgggtggcgctgacctg
atgggttgtgagaatgtgtaggtgaatcccaggtagaatcccagggcctgggattcactg

 1.13 Intr +   8079   8227  149  1  2   61   99   167 0.999  15.56
ttctctggacctcagcctccttgcctatgaaattgaattaatggcacctcctccccttcg
ggcttgctgcgagagaggaagggcatgagtgggtttacaagcgcctggagcagctttgtc
catcgtccgggcggcaagcgttgtcagatggggtgtgaagaaggcgctctgtgttcgcag
GGGCGGAGGAATATGCCAGCTTCCTGCAGGAGGCGCAGGTACCGTTCCTCTCCCTGGAGC
GCTGCTCAGCCCCGGACGTGCACGGATCCTCCATCCTCCCCGGCATGCTCTGCGCAGGGT
TCCTCGAGGGCGGCACCGATGCGTGCCAG
gtgagctcttagcccggttggcgcccttccccgaggccgtcaggcacaaatctcaggtcc
acagcgctgagctgcgtgtttccgacccagggtgattccggaggcccgctggtgtgtgag
gaccaagctgcagagcgccggctcaccctgcaaggcatcatcagctggggatcgggctgt

 1.14 Term +   8318   8485  168  1  0   53   38   273 0.999  16.99
cgctgctcagccccggacgtgcacggatcctccatcctccccggcatgctctgcgcaggg
ttcctcgagggcggcaccgatgcgtgccaggtgagctcttagcccggttggcgcccttcc
ccgaggccgtcaggcacaaatctcaggtccacagcgctgagctgcgtgtttccgacccag
GGTGATTCCGGAGGCCCGCTGGTGTGTGAGGACCAAGCTGCAGAGCGCCGGCTCACCCTG
CAAGGCATCATCAGCTGGGGATCGGGCTGTGGTGACCGCAACAAGCCAGGCGTCTACACC
GATGTGGCCTACTACCTGGCCTGGATCCGGGAGCACACCGTTTCCTGA
ttgctcagggactcatctttccctccttggtgattccgcagtgagagagtggctggggca
tggaaggcaagattgtgtcccattcccccagtgcggccagctccgcgccaggatggcgca
ggaactcaataaagtgctttgaaaatgctgagaaggaaagctcttttcttcatgggtccc

Predicted peptide sequence(s):


>F12_1|GENSCAN_predicted_peptide_1|694_aa
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRAPGSRRSNGAPSCGYRNPDNDIRPWCFVLNRDR
LSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAK
REQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAP
CWVLTAAHCLQDRRRSFHAAPEPVPYLLPPHPSFHAPPELPGRKLEHGIGVREQGASPER
LWPGLRALPLPYPPRRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHD
LALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQE
AQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQ
GIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS