GENSCAN 1.0	Date run: 16-Jan-104	Time: 14:06:36

Sequence CLK4_1 : 22545 bp : 37.54% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   4721   4779   59  1  2  100   80    35 0.249   0.66
gttgtaaagatgcttctatttctgcctaaaccagccccctgggaaaaagaatgacagcat
attctggggaaaggaaaggggttggtgagggcaatctagtcaacatccgtcactccattg
cttgttaggcttattttagccgatgtgtctgactgggcaggtgtcccctctctccctcag
TGCTCCATGTGCATCCCTCTTGAAGCTTCGCACTCTGTTGAAGAGGACACTCATCCCAG
gtagagagggggacgggaaactgggccaattgaatctatgtccttttctttccatcagat
caaggccacttaactgggatccattgacatcctgaggcccatgacctttgaaattccttg
ccaagttttgtttatgtgtttcttaggaaagagagtccatggctttcagcagattttcaa

 1.02 Intr +   5839   6061  223  1  1   56   68   269 0.517  18.91
gtttgttaaagtaaaattatttcttaagctttatgagataaatataaatgctaattcatc
tgtttgaatttttttcttatattgagttagctgtttaagaatttctgagaaaatgttttg
tttgaaccacattattgcagaatgaagagaataatttgaaatcttttaatgtgtttgcag
TCATTATTTAGAAGCAAGGTCCTTGAATGAGCGAGATTATCGGGACCGGAGATACGTTGA
CGAATACAGGAATGACTACTGTGAAGGATATGTTCCTAGACATTATCACAGAGACATTGA
AAGCGGGTATCGAATCCACTGCAGTAAATCTTCAGTCCGCAGCAGGAGAAGCAGTCCTAA
AAGGAAGCGCAATAGACACTGTTCAAGTCATCAGTCACGTTCG
gtatgattggttttgttttcaatttgagtggagttttatttgtgtgtactcttaacgagc
tgataagtttctaattttttatatatatatatataaaatactatttggatatattataat
tgtatttatattacttaaatccttaaaggaaacctccaaattcttgtagctgatctgtat

 1.03 Intr +   7183   7231   49  0  1   58    3    48 0.292  -9.37
ctgtgccctgtgaatttctggggactgaatttgaaattgctcctgccaactgttcgtggc
ctggtgcttatctgaatgcctgaatatctccccgctgaatgaattgcgtattctgccctg
aattcactctgatatattgattggctggacgatcttggtgctgcccacttgccgttccag
AAGAGCCACCGAAGGAAAAGATCCAGGAGTATAGAGGATGATGAGGAGG
gtcacctgatctgtcaaagtggagacgttctaagagcaagatgtatagaatatttttcaa
cactttttaaactttgcagaaagaataatctttttaagaatagtttgtcagcggggggct
aaagaactcttcattgcttttttattttgctttttgtgggtttgtttgttcttttatatt

 1.04 Intr +   7669   7735   67  2  1  109  103   111 0.877  11.74
aagatagctctatctaattgtttttgtagcagctgaaactaaaataatttgagtgctgaa
accttagttatgctttgttagagatcatttgaaaatattccacacttaagcattcattgt
ttgaagaactagacagtttgtactcaggtacttacacctctttttccctcctcactctag
ATGAAATCGTGGACACTTTGGGTGAAGGAGCCTTTGGCAAAGTTGTAGAGTGCATTGATC
ATGGCAT
gtaagtttgttttttccttttcaaacattctgatgtttttggtggggaaagattcataat
tcagatgaaattttatttatttatttatttgagatagggcctctgttgcccaggcttgag
tgcagtggtgctatcttggctcactgcaactgccgcctcccggcttcaagtgattctcct

 1.05 Intr +  10774  10890  117  1  0   67   89   126 0.962   9.26
tataaagtattttatcaaaatgttttaagaagatgttatatggaatctgctataatatgt
tctgaaagattattttaaatggcatagaggaattggtaattaagactatgctttagagca
taacatggcttcagctcactcttgtacatttatcatttttatcttaattttatttttaag
GGATGGCATGCATGTAGCAGTGAAAATCGTAAAAAATGTAGGCCGTTACCGTGAAGCAGC
TCGTTCAGAAATCCAAGTATTAGAGCACTTAAATAGTACTGATCCCAATAGTGTCTT
gtaagtataactttcacctaggagccatcatattacatgaaatattcaggtttccataaa
ctgaattattattttgctctgttttagccgatgtgtccagatgctagaatggtttgatca
tcatggtcatgtttgtattgtgtttgaactactgggacttagtacttacgatttcattaa

 1.06 Intr +  10978  11144  167  1  2   82   87   116 0.999   9.58
aatcgtaaaaaatgtaggccgttaccgtgaagcagctcgttcagaaatccaagtattaga
gcacttaaatagtactgatcccaatagtgtcttgtaagtataactttcacctaggagcca
tcatattacatgaaatattcaggtttccataaactgaattattattttgctctgttttag
CCGATGTGTCCAGATGCTAGAATGGTTTGATCATCATGGTCATGTTTGTATTGTGTTTGA
ACTACTGGGACTTAGTACTTACGATTTCATTAAAGAAAACAGCTTTCTGCCATTTCAAAT
TGACCACATCAGGCAGATGGCGTATCAGATCTGCCAGTCAATAAATT
gtaagtacacttgataaatctttatttttatttatttatttatttatttattttgagacg
gagtctcgctctgtcacccaggctggagtgcagtggcgctctcgggtcccagcaagctca
gcctcccgggttcacgccattttcctgcctcagcctcccgagtagctgggactacaggcg

 1.07 Intr +  11727  11821   95  1  2  101  115    13 0.999   4.06
agaaaacttgtttttattatacaagctatatatccaaatgttgtcactaaaaaaacagac
attttacaagtaaagatgaatcgtctcttgaccactatatcctttgccagtcctcctttc
cctcctagtacaaattaagtttgtaagtgaaactaataatgtgcttttgttctcttgtag
TTTTACATCATAATAAATTAACCCATACAGATCTGAAGCCTGAAAATATTTTGTTTGTGA
AGTCTGACTATGTAGTCAAATATAATTCTAAAATG
gtaagttaaagacttgttttaatttgggtggttgtctttaaaattaatttaacttgatga
tctttggatgaggaatttcacttctgagccttattatatcctgttgtttaaccaaaaaga
agtaatccttctttgcctttctcatgagcttactttgacaatcaagaagataattcatgt

 1.08 Intr +  12072  12191  120  2  0   63   26   199 0.254  10.97
aggaatttcacttctgagccttattatatcctgttgtttaaccaaaaagaagtaatcctt
ctttgcctttctcatgagcttactttgacaatcaagaagataattcatgtgctggccttt
tgagtagcgctataaaatgtatctattgagtttcatgtttactcaactgtgtctctctag
AAACGTGATGAACGCACACTGAAAAACACAGATATCAAAGTTGTTGACTTTGGAAGTGCA
ACGTATGATGATGAACATCACAGTACTTTGGTGTCTACCCGGCACTACAGAGCTCCCGAG

gtcattttgggtcagtagacaccaggctttctaatattataattgaagaagagatttttg
ttctttacagctttactggtggggtggggaagtatgatcttctcagcaggattcagaaaa
cgttttctattttcataaaaaatgtgtggacattgctataaatacttttcctgagtggta

 1.09 Intr +  19235  19314   80  1  2   54   95    55 0.235   0.23
taattttggttaagcagctgattaaatgaggagacagtttttctggtaaccttgcccagt
tattctttaaacagtgtaagaagtgcaaataaagaaggaaactaaaattttagattaaac
aagttaatgtgtttgtagggaaatggagagtactaaatttctttttcttacatgttttag
ACTCATGATAGTAAAGAGCACCTGGCAATGATGGAACGAATATTAGGACCCATACCACAA
CACATGATTCAGAAAACAAG
gtatgttttaagattcaagacttttgttggatatgtgcaatagcatatattcaaactaca
gaaaacccaacgttgttgtaatactgattccaaggactatagattttgactttttttttt
ttttctgtactggaggtaacttctaacttcatcttactcctttttttttttttgagatgg

 1.10 Intr +  20683  20773   91  1  1   88   93    21 0.565   1.68
ggaggatatgaggtgtccgatatataattgttgctgaggtttttaaaaattgtatgcatc
tatattatataagtctatacacttagagagagctgctttccatgtctcccctcatgggtg
cagggtaaagatacgactcttgttattttactaatccagactttttttttttttctgtag
AAAACGCAAGTATTTTCACCATAACCAGCTAGATTGGGATGAACACAGTTCTGCTGGTAG
ATATGTTAGGAGACGCTGCAAACCGTTGAAG
gtaaaagaaaaaagattaaaggttaaataaaccacgtgtttgcactattaataatttttt
ttaaaacaaaaacatttctcccccaggaatttatgctttgtcatgatgaagaacatgaga
aactgtttgacctggttcgaagaatgttagaatatgatccaactcaaagaattaccttgg

 1.11 Term +  20860  21000  141  0  0   79   44   133 0.888   4.95
tagaaaacgcaagtattttcaccataaccagctagattgggatgaacacagttctgctgg
tagatatgttaggagacgctgcaaaccgttgaaggtaaaagaaaaaagattaaaggttaa
ataaaccacgtgtttgcactattaataattttttttaaaacaaaaacatttctcccccag
GAATTTATGCTTTGTCATGATGAAGAACATGAGAAACTGTTTGACCTGGTTCGAAGAATG
TTAGAATATGATCCAACTCAAAGAATTACCTTGGATGAAGCATTGCAGCATCCTTTCTTT
GACTTATTAAAAAAGAAATGA
aatgggaatcagtggtcttactatatacttctctagaagagattacttaagactgtgtca
gtcaactaaacattctaatatttttgtaaacattaaattattttgtacagttaagtgtaa
atattgtatgttttgtatcaatagcataattaacttgttaagcaagtatggtcttgataa

Predicted peptide sequence(s):


>CLK4_1|GENSCAN_predicted_peptide_1|402_aa
CSMCIPLEASHSVEEDTHPSHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIE
SGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKSHRRKRSRSIEDDEEDEIVDTLGEG
AFGKVVECIDHGMDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEW
FDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLK
PENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPET
HDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEHSSAGRYVRRRCKPLKEFML
CHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKKK