GENSCAN 1.0	Date run: 16-Jan-104	Time: 11:11:08

Sequence CCNB1_1 : 13006 bp : 43.49% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1378   1398   21  0  0  104   84    37 0.463   4.52
gccacgaacaggccaataaggagggagcagtgcggggtttaaatctgaggctaggctggc
tcttctcggcgtgctgcggcggaacggctgttggtttctgctgggtgtaggtccttggct
ggtcgggcctccggtgttctgcttctccccgctgagctgctgcctggtgaagaggaagcc
ATGGCGCTCCGAGTCACCAGG
gtgagccgcttcggactgcgaactaacgcggccttcttagctgctgcctgctctccctgc
ctcgcctgcgggagcctcccgagcgggagagggccgcaggagcgatttggggaggaaggt
gggaggggactcaccaagagagcgccgaggtgggcccaggcctggtgagagagtgtgggg

 1.02 Intr +   2023   2193  171  0  0   86   88   134 0.988  13.34
ggtcggcggaaactgacttgtcacggccgcagagtagactctgggacccatgttttccct
cggaacccatttttagtcggctttctttctgggaacttctccttgtgccccaccttaatt
aacccttgacttactcgagccttcgtggatcagctcttaaagtggtcttgcttctttcag
AACTCGAAAATTAATGCTGAAAATAAGGCGAAGATCAACATGGCAGGCGCAAAGCGCGTT
CCTACGGCCCCTGCTGCAACCTCCAAGCCCGGACTGAGGCCAAGAACAGCTCTTGGGGAC
ATTGGTAACAAAGTCAGTGAACAACTGCAGGCCAAAATGCCTATGAAGAAG
gtaactctcttcctgacctaacttctgtaagagcccgccttccaactgtggcctttgatg
cagaaacatttcattctctctgtttcatctacaggaagcaaaaccttcagctactggaaa
agtcattgataaaaaactaccaaaacctcttgaaaaggtacctatgctggtgccagtgcc

 1.03 Intr +   2288   2458  171  1  0  103   25   115 0.947   6.84
agcccggactgaggccaagaacagctcttggggacattggtaacaaagtcagtgaacaac
tgcaggccaaaatgcctatgaagaaggtaactctcttcctgacctaacttctgtaagagc
ccgccttccaactgtggcctttgatgcagaaacatttcattctctctgtttcatctacag
GAAGCAAAACCTTCAGCTACTGGAAAAGTCATTGATAAAAAACTACCAAAACCTCTTGAA
AAGGTACCTATGCTGGTGCCAGTGCCAGTGTCTGAGCCAGTGCCAGAGCCAGAACCTGAG
CCAGAACCTGAGCCTGTTAAAGAAGAAAAACTTTCGCCTGAGCCTATTTTG
gtaaacttattcttaccattgtagagtctgttgattatttcttgtcccttatttcactga
tacatgcaagagcattcaaatgaatagtaatattaataccatttattgagtgcttagcat
gaggcaagctctgcctaacattttacatgcattaactcacataatctttacacgtactct

 1.04 Intr +   5385   5567  183  2  0   73  107   114 0.895  11.78
gttaatcacttcctaaaaagaaatggaataaatctgaaaagatacttttcctttaaggaa
atgaattgtatgccgattcagcagaatactagcttgagttggtaccaataacctgaactt
catgcccaaactatagtgcttacttctatttgctatttcaagatatctctttgtttcaag
GTTGATACTGCCTCTCCAAGCCCAATGGAAACATCTGGATGTGCCCCTGCAGAAGAAGAC
CTGTGTCAGGCTTTCTCTGATGTAATTCTTGCAGTAAATGATGTGGATGCAGAAGATGGA
GCTGATCCAAACCTTTGTAGTGAATATGTGAAAGATATTTATGCTTATCTGAGACAACTT
GAG
gtaagtattatcattcgttttttttctaaactgcatctaactttatgaaagtattttcca
tcaatagtttataataatacaagcaggacgtgggcagcatttcttaagagatcgcacttt
caaattctccttcatggaatacctataataaaaagtcactaaataaaccaatggagtcta

 1.05 Intr +   8366   8524  159  1  0   73   99    54 0.901   5.18
atgtttgctttatttcttggtgatggtgttgtttgtggttgaccatatgaataattgaat
taagaactgatatagattataaatgccccagtgctactgtaggaactaactgatctttct
ggacataaatgtgtcacatggagtcatgtttctaagaataatcagcattttcttttgcag
GAAGAGCAAGCAGTCAGACCAAAATACCTACTGGGTCGGGAAGTCACTGGAAACATGAGA
GCCATCCTAATTGACTGGCTAGTACAGGTTCAAATGAAATTCAGGTTGTTGCAGGAGACC
ATGTACATGACTGTCTCCATTATTGATCGGTTCATGCAG
gtgagcatttcagtaagagttttcccttccaggattctagccgagtcataagaaactgat
gttttcaggccagtctgggcgcagtggctcatgcctgtaatcccagcgggcgggtggatc
acaaggttaggagatcgagaccatcctggccaacgcagtaaaaccctgtctctactaaaa

 1.06 Intr +   8992   9228  237  0  0   69   77   136 0.959   8.41
agagcgagactcaaaaaaaaaagaaagaaataaactgactttttcaactaaaatctttct
tgggggatatggtgtcattaagattttgctatgggagaatgtctttctacctctccttca
tcatagctctgtgtctccttttcaaacattttattcaccctattgaaattcccattgcag
AATAATTGTGTGCCCAAGAAGATGCTGCAGCTGGTTGGTGTCACTGCCATGTTTATTGCA
AGCAAATATGAAGAAATGTACCCTCCAGAAATTGGTGACTTTGCTTTTGTGACTGACAAC
ACTTATACTAAGCACCAAATCAGACAGATGGAAATGAAGATTCTAAGAGCTTTAAACTTT
GGTCTGGGTCGGCCTCTACCTTTGCACTTCCTTCGGAGAGCATCTAAGATTGGAGAG
gtacaggtttcttgagaaacctctccgtatgggtacattagggggaacactgctgctgac
caagcacgttgaattcaactgacctgtattatacctaactacatggggaagggataaagt
tgttctttatttctagtcaggctgcatgttaatattaggactttccatgggcatttgaga

 1.07 Intr +   9512   9652  141  1  0   36   94    54 0.697   1.35
tggggaagggataaagttgttctttatttctagtcaggctgcatgttaatattaggactt
tccatgggcatttgagagtttgtagacaaacatttgtagttaaagatacatatgggcatg
caggttagtgccaaaggaaaattttctgaaagaaactcagtaacatgggttttgtttcag
GTTGATGTCGAGCAACATACTTTGGCCAAATACCTGATGGAACTAACTATGTTGGACTAT
GACATGGTGCACTTTCCTCCTTCTCAAATTGCAGCAGGAGCTTTTTGCTTAGCACTGAAA
ATTCTGGATAATGGTGAATGG
gtaagctgtgtcccacagaactcctaagcttttaaattttaaagagtgactaaatacaga
acttttgttattaaaaggcaattcaagtggttcataaatatgggatctactgaaggaata
gttaaaaaagatgtcttagaatgtttccacatctttttgtttttgagacaaggtctcgct

 1.08 Intr +  11354  11464  111  1  0   42  101    40 0.697   1.28
tttgagcagaggaagcatgagagcacctaggaaaggagtctttagctttgtcttaaattt
cagttatattaattatacagtacccatctcttttccactcctgaataacatctaacatct
agaaactttatgaaaatcattattgatttgagcatttttaacattaacttgttgccttag
ACACCAACTCTACAACATTACCTGTCATATACTGAAGAATCTCTTCTTCCAGTTATGCAG
CACCTGGCTAAGAATGTAGTCATGGTAAATCAAGGACTTACAAAGCACATG
gtgagtcaatatagtggcattgtaagatgctgaaaagtgtaataattcaaacttaatgcc
tgcaaatgcctggtttatttttaatgagttaatgttttaaatgaatacctgtatcattgc
atcttgtgattttttttcttttgcctctttaattgctatctttttgtcttccagactgtc

 1.09 Term +  11639  11746  108  1  0  127   32    98 0.957   6.61
cacatggtgagtcaatatagtggcattgtaagatgctgaaaagtgtaataattcaaactt
aatgcctgcaaatgcctggtttatttttaatgagttaatgttttaaatgaatacctgtat
cattgcatcttgtgattttttttcttttgcctctttaattgctatctttttgtcttccag
ACTGTCAAGAACAAGTATGCCACATCGAAGCATGCTAAGATCAGCACTCTACCACAGCTG
AATTCTGCACTAGTTCAAGATTTAGCCAAGGCTGTGGCAAAGGTGTAA
cttgtaaacttgagttggagtactatatttacaaataaaattggcaccatgtgccatctg
tacatattactgttgcatttacttttaataaagcttgtggccccttttacttttttatag
cttaactaatttgaatgtggttacttcctactgtagggtagcggaaaagttgtcttaaaa

Predicted peptide sequence(s):


>CCNB1_1|GENSCAN_predicted_peptide_1|433_aa
MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKM
PMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPI
LVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQ
LEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVP
KKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGE
WTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNS
ALVQDLAKAVAKV