GENSCAN 1.0	Date run: 16-Jan-104	Time: 13:31:42

Sequence APC_1 : 93466 bp : 37.29% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1221   1355  135  2  0   79   64   135 0.905  10.39
tgctgctacttgaacaatattgttttgagaccaaaaactagcatattaacacaattcttc
ttaaacgtcttaagagttttgtttcctttacccctttctttaaaaacaagcagccactaa
attttttagtagtgaatttcaaaatcctttttaaccttataggtccaagggtagccaagg
ATGGCTGCAGCTTCATATGATCAGTTGTTAAAGCAAGTTGAGGCACTGAAGATGGAGAAC
TCAAATCTTCGACAAGAGCTAGAAGATAATTCCAATCATCTTACAAAACTGGAAACTGAG
GCATCTAATATGAAG
gtatcaagactgtgacttttaattgtagtttatccatttttattcagtattccctcttgt
aaacttgaggtaagacactttacttaaaagtgtattttaaattaagcaataatatgtaaa
ctctttcttgcaaaagttagcatttatatttttaaataagatatattgaattcattcagt

 1.02 Intr +  12656  12740   85  1  1  104   71   108 0.998   9.17
actattattatttggccatgatttatttattaataatgaataataggtaatatatataag
gtgcgtgctttgagagtgatctgaatttttttctcagcatacttaaatgtcaagaaatac
agaatcatgtcttgaagttatttagaatttcatgttaatatattgtgttctttttaacag
GAAGTACTTAAACAACTACAAGGAAGTATTGAAGATGAAGCTATGGCTTCTTCTGGACAG
ATTGATTTATTAGAGCGTCTTAAAG
gtagattttaaaaaggtgttttaaaataattttttaagctcaaattgtcatctttaggtg
tgtagatccaagtacagcttctctcgatttgggtgttggtatcagttttcttggtatgtt
agccttaccctcaggatgtaattgttaaagtacaaataaataaaaaatgtatttgtgtgt

 1.03 Intr +  13519  13720  202  2  1   56   78   158 0.835   9.02
tttttaccctgacccaagtggacttttcagggaaagtcctaaataatttttgttttcagt
catgtatatttgtggttaaaatgtaaacctaatatttcactttaaaataatataacatta
agaatattttagactgcttaaagcaattgttgtataaaaacttgtttctattttatttag
AGCTTAACTTAGATAGCAGTAATTTCCCTGGAGTAAAACTGCGGTCAAAAATGTCCCTCC
GTTCTTATGGAAGCCGGGAAGGATCTGTATCAAGCCGTTCTGGAGAGTGCAGTCCTGTTC
CTATGGGTTCATTTCCAAGAAGAGGGTTTGTAAATGGAAGCAGAGAAAGTACTGGATATT
TAGAAGAACTTGAGAAAGAGAG
gtaacttttcttcatatagtaaacattgccttgtgtactccagtttattgttattttgta
atataatatttaaattgtgaatttatagtaggtgatagctaacacttagagcattttgca
tttttaaactcaaagatagcatgttattgattgcacttacattaaatctaaaaatataaa

 1.04 Intr +  21959  22067  109  2  1   -9  101   117 0.095   2.67
aatgactgtaatattctaagtcctacctttaaaaattgaaatcaatgtaaattttttgag
taattcattattagcactttaggtagagaagtttgcaataacaactgatgtaagtattgc
tcttctgcagtctttattagcattgtttaaacgtacctttttttaaaaaaaaaaaaatag
GTCATTGCTTCTTGCTGATCTTGACAAAGAAGAAAAGGAAAAAGACTGGTATTACGCTCA
ACTTCAGAATCTCACTAAAAGAATAGATAGTCTTCCTTTAACTGAAAAT
gtaagtaacttggcagtacaacttatttgaaactttaataacttgatattttaaagtacc
taggtaatccattaaaattcaggataactgaatttatagttatttgtaaattgcaatatg
ttttacccaactttaggcctgaatatataatagttaatgaatttttgttggtaaagatga

 1.05 Intr +  27120  27233  114  2  0   45  111    87 0.083   6.42
ttgagtctgacacctataatcaaatttaaacactccttggagtaaaaaataattttctca
tgcaccatgactgacgtatttgcttattcattttctttattggttcttatatgctttttt
gcttttactgattaacgtaaatacaagatattgatacttttttattatttgtggttttag
TTTTCCTTACAAACAGATATGACCAGAAGGCAATTGGAATATGAAGCAAGGCAAATCAGA
GTTGCGATGGAAGAACAACTAGGTACCTGCCAGGATATGGAAAAACGAGCACAG
gtaagttacttgtttctaagtgataaaacagcgaagagctattaggaataaaatgaatta
cagctctgttaatattgattaaattttattaaagacataaggctgtgtttattttggctc
tatttcaaaataagatttatcatggctgctgagcaacataatcaatattcacatagttgt

 1.06 Intr +  38776  38859   84  0  0   89   88    74 0.493   6.60
aaagaaaaattgaactgaccccaatttgttattaaagggtgaatatatttatatgtctag
ctttttaaatgagaatgatttgacataaccctgagcttttaagtggtagccatagtatga
ttatttctattaatattattaataaaaacataactaattaggtttcttgttttattttag
CGAAGAATAGCCAGAATTCAGCAAATCGAAAAGGACATACTTCGTATACGACAGCTTTTA
CAGTCCCAAGCAACAGAAGCAGAG
gttagtaaattgcctttcttgtttgtgggtataaaaataggtagttattctgagaaaaga
aaacatgtataatttaatgtgacaccattgaaatatagatgttctttcagagaatttaaa
taccgtaatttttttcgtgaaattaaattatcaaagatttggactattttgattttatct

 1.07 Term +  40760  40936  177  1  0   24   32   167 0.473   1.40
tttgtattttttgtagagacgaggttttgccatgttgcccaggctggtctcgaactcctg
agctcaagcaatctgcctgtcttggccttccaaagtgtgggattacaggcgtgagccact
gcgcctgacccctgttaaaccttttaaaagaaaatatgtgcagctatgttttgaccccag
TTCTTTGACACCACTGTATATCCTCCAGTTGGGTTCAATTTTGATCCTAACTACCCAGAG
TTAGAGTCAGCTCCACAAGTAAAAGACAAAGTCAGTCACAAGACTGTCCACTTCAAACGC
CAGCCACAAGTTTTGGGTGTCCCTAAGCCACCAGGACTGCTGCCAAGCTGTCTATAA
attccaccccgtgtgcgtgtgctgtggtaccattccattctcacactaactacccagagt
tagcacagccccaacaggttaagagccgactccttcacaagactgctcccacctcagatg
ccagccacaaatgttgagtatctccaagccactcacatttctgcccagtgtgttacaaat

 2.04 PlyA -  43269  43264    6                               1.05
 2.03 Term -  45048  44914  135  0  0   81   43    55 0.646  -2.66
 2.02 Intr -  47522  47431   92  0  2   65   99    94 0.608   6.99
 2.01 Init -  60310  60184  127  1  1   88   49   155 0.909  11.97
 2.00 Prom -  64551  64512   40                              -1.65

 3.01 Init +  65302  65674  373  0  1   75   55   181 0.813  10.67
taacactgattacttcatcctggaaaggttttccggttttttgttttttttttggcgggg
ggggttgttttgtttttttagagttatagtaaatatcccattcatcacttaattggtttt
tggcttttggatattaaagtcgtaattttgtttctaaactcatttggcccacaggtggaa
ATGGTGTATTCATTGTTGTCAATGCTTGGTACTCATGATAAGGATGATATGTCGCGAACT
TTGCTAGCTATGTCTAGCTCCCAAGACAGCTGTATATCCATGCGACAGTCTGGATGTCTT
CCTCTCCTCATCCAGCTTTTACATGGCAATGACAAAGACTCTGTATTGTTGGGAAATTCC
CGGGGCAGTAAAGAGGCTCGGGCCAGGGCCAGTGCAGCACTCCACAACATCATTCACTCA
CAGCCTGATGACAAGAGAGGCAGGCGTGAAATCCGAGTCCTTCATCTTTTGGAACAGATA
CGCGCTTACTGTGAAACCTGTTGGGAGTGGCAGGAAGCTCATGAACCAGGCATGGACCAG
GACAAAAATCCAA
gtatgttctctatagtgtacatcgtagtgcatgtttcaaagcaaatgtgaaatttttaaa
cagaaaacatgtttagttaatatgctgtctttatgactaagaggagaaaattcatatcag
ccatttgtgctactcatatttaaaagattaagtctgtatttccctagaaaaatttagcaa

 3.02 Intr +  68226  68321   96  1  0   62   82    49 0.614   0.76
tcctattttttgttccacatttgtagtatttattcatcctttcagcaaatatttgttgat
ccactaaaattccgtgaattagggttatattagtgatccctgcatatttttaaagtacaa
taaacatcattgctcttcaaataacaaagcattatggtttatgttgattttatttttcag
TGCCAGCTCCTGTTGAACATCAGATCTGTCCTGCTGTGTGTGTTCTAATGAAACTTTCAT
TTGATGAAGAGCATAGACATGCAATGAATGAACTAG
gtaagacaaaaatgttttttaatgacatagacaattactggtggatttttaaatcatggt
agaaattcagtatagtaaataaagatttttaatcattgatgaattaggatataaggccac
caacttctgttatcagctgcttcctctgtgtagcaaaaaattgtaccctggtttccagca

 3.03 Intr +  69637  69807  171  2  0  137  -22   134 0.276   6.29
taacaggaaggggataaaaaataatgaataaacaggaaaacattcagttttaagatacct
caaaagttattctgtaaatgttcctgtattccaatggattgtagactaggactgagacat
taatcatctggatttcaaaataaaacctagactcagtatttgttcctcttccttcttcag
GTAGGAAGGCTACCCGGGGCATTTCATCACAGGAGCTAGGGCAGGGGCTTTCAGGTGAGG
AGCAGGATGGGGCCTCTGGGGGTGTGACTGCTGGGGACATAGCCACAGGGGATTACCTTC
TTCTCACTCCTCACCTCCAGATTTGCACTGGGGCAAAAGGAGGATTAGGGT
gtgtggattgcggggagataatagtacaagacagcacaaggttttggcagtaagggataa
ggagaaaagaaatcccaaataggtaaaggggaattccttagttcagtcagctgggatggt
catttgtacatatatgaagattctacagctatcagtcatttaagtttgcacttattagta

 3.04 Intr +  73438  73577  140  2  2   67   95   147 0.904  12.56
taaatatattatacagaagttctttataacagtttttgtagcttataattctaaaggcaa
atttaaaccatatattctcattgattgagtttttttttcctagtatttaagttaccaact
tggtaccagtttgttttattttagatgattgtctttttcctcttgccctttttaaattag
GGGGACTACAGGCCATTGCAGAATTATTGCAAGTGGACTGTGAAATGTATGGGCTTACTA
ATGACCACTACAGTATTACACTAAGACGATATGCTGGAATGGCTTTGACAAACTTGACTT
TTGGAGATGTAGCCAACAAG
gtatgtttttataacatgtatttcttaagatagctcaggtatgagttaatttactttcat
acaaatacattttactgattttcttttttttcactctcctcattaaacaatgactgataa
aaacctgtgcttcacattcgcttatctttactcatttgtttgtcttatgcctaaacaaag

 3.05 Intr +  74259  74336   78  2  0   97   79    60 0.965   4.83
agaattaggagaatatttgtcttttatttaggtaatcttattctagattttttatgagtg
aagtatcagttatgattaaaacaaaataatgaaaactgaattagacatttagtagccaaa
aataaagcttggcttcaagttgtctttttaatgatcctctattctgtatttaatttacag
GCTACGCTATGCTCTATGAAAGGCTGCATGAGAGCACTTGTGGCCCAACTAAAATCTGAA
AGTGAAGACTTACAGCAG
gtactatttagaatttcacctgtttttcttttttctctttttctttgaggcagggtctca
ctctgtcacccaggcttagagggcagttgtgcaatctcagctcactgcaacctctgcctc
cagggttcaagcaatcctcccacttcagcctctcgaggctgggcctacaggtgcacacca

 3.06 Intr +  75186  75302  117  2  0   65   77   115 0.995   7.84
tggtctcaggagatcctcctgcctcagcctcccaaagtgataggattacaggcgtgagtc
accacggctagccagaatttctttcttaatagatttctattcttactgctagcattaaaa
acaaaaaagcaactagtatgattttatgtataaattaatctaaaattgattaatttgcag
GTTATTGCGAGTGTTTTGAGGAATTTGTCTTGGCGAGCAGATGTAAATAGTAAAAAGACG
TTGCGAGAAGTTGGAAGTGTGAAAGCATTGATGGAATGTGCTTTAGAAGTTAAAAAG
gtacctttgaaaacatttagtactataatatgaatttcatgtttggcttttttttgctgc
cttcttttagccatgagatttcctaatttcttacctgtgtattattcagtactataatat
gaatttcatgtttagctttttttgctgccttcttttagccatgagattccctaatttctt

 3.07 Intr +  81281  81495  215  1  2  102   76   180 0.975  14.79
tataaatactatttggtattttatgaacatttttctaaatggaaagttcttaatttacca
gtgagggacgggcaataggatagattaaaaaatagcttttattcaatatcagtaacatag
aagttaatgagagacaaattccaactctaattagatgacccatattctgtttcttactag
GAATCAACCCTCAAAAGCGTATTGAGTGCCTTATGGAATTTGTCAGCACATTGCACTGAG
AATAAAGCTGATATATGTGCTGTAGATGGTGCACTTGCATTTTTGGTTGGCACTCTTACT
TACCGGAGCCAGACAAACACTTTAGCCATTATTGAAAGTGGAGGTGGGATATTACGGAAT
GTGTCCAGCTTGATAGCTACAAATGAGGACCACAG
gtatatatagagttttatattacttttaaagtacagaattcatactctcaaaaagaccta
attgtaagcaatgttttatataatcatgaaagttttaagccaaaatatatttattactgt
gaaaagataactactaactcttagtttaactcattagtgtacttaatgtaataacagttt

 3.08 Term +  83883  90456 6574  0  1   90   42  5128 0.949 492.83
gattagtactttaaaacattaaacattacatgaaattagaacaaaaggagatgtggaata
cttggaatttataggataattggtacaatcatattatgccttttgtcttctatcctttta
tttgttgttactgcatacacattgtgaccttaattttgtgatctcttgattttatttcag
GCAAATCCTAAGAGAGAACAACTGTCTACAAACTTTATTACAACACTTAAAATCTCATAG
TTTGACAATAGTCAGTAATGCATGTGGAACTTTGTGGAATCTCTCAGCAAGAAATCCTAA
AGACCAGGAAGCATTATGGGACATGGGGGCAGTTAGCATGCTCAAGAACCTCATTCATTC
AAAGCACAAAATGATTGCTATGGGAAGTGCTGCAGCTTTAAGGAATCTCATGGCAAATAG
GCCTGCGAAGTACAAGGATGCCAATATTATGTCTCCTGGCTCAAGCTTGCCATCTCTTCA
TGTTAGGAAACAAAAAGCCCTAGAAGCAGAATTAGATGCTCAGCACTTATCAGAAACTTT
TGACAATATAGACAATTTAAGTCCCAAGGCATCTCATCGTAGTAAGCAGAGACACAAGCA
AAGTCTCTATGGTGATTATGTTTTTGACACCAATCGACATGATGATAATAGGTCAGACAA
TTTTAATACTGGCAACATGACTGTCCTTTCACCATATTTGAATACTACAGTGTTACCCAG
CTCCTCTTCATCAAGAGGAAGCTTAGATAGTTCTCGTTCTGAAAAAGATAGAAGTTTGGA
GAGAGAACGCGGAATTGGTCTAGGCAACTACCATCCAGCAACAGAAAATCCAGGAACTTC
TTCAAAGCGAGGTTTGCAGATCTCCACCACTGCAGCCCAGATTGCCAAAGTCATGGAAGA
AGTGTCAGCCATTCATACCTCTCAGGAAGACAGAAGTTCTGGGTCTACCACTGAATTACA
TTGTGTGACAGATGAGAGAAATGCACTTAGAAGAAGCTCTGCTGCCCATACACATTCAAA
CACTTACAATTTCACTAAGTCGGAAAATTCAAATAGGACATGTTCTATGCCTTATGCCAA
ATTAGAATACAAGAGATCTTCAAATGATAGTTTAAATAGTGTCAGTAGTAGTGATGGTTA
TGGTAAAAGAGGTCAAATGAAACCCTCGATTGAATCCTATTCTGAAGATGATGAAAGTAA
GTTTTGCAGTTATGGTCAATACCCAGCCGACCTAGCCCATAAAATACATAGTGCAAATCA
TATGGATGATAATGATGGAGAACTAGATACACCAATAAATTATAGTCTTAAATATTCAGA
TGAGCAGTTGAACTCTGGAAGGCAAAGTCCTTCACAGAATGAAAGATGGGCAAGACCCAA
ACACATAATAGAAGATGAAATAAAACAAAGTGAGCAAAGACAATCAAGGAATCAAAGTAC
AACTTATCCTGTTTATACTGAGAGCACTGATGATAAACACCTCAAGTTCCAACCACATTT
TGGACAGCAGGAATGTGTTTCTCCATACAGGTCACGGGGAGCCAATGGTTCAGAAACAAA
TCGAGTGGGTTCTAATCATGGAATTAATCAAAATGTAAGCCAGTCTTTGTGTCAAGAAGA
TGACTATGAAGATGATAAGCCTACCAATTATAGTGAACGTTACTCTGAAGAAGAACAGCA
TGAAGAAGAAGAGAGACCAACAAATTATAGCATAAAATATAATGAAGAGAAACGTCATGT
GGATCAGCCTATTGATTATAGTTTAAAATATGCCACAGATATTCCTTCATCACAGAAACA
GTCATTTTCATTCTCAAAGAGTTCATCTGGACAAAGCAGTAAAACCGAACATATGTCTTC
AAGCAGTGAGAATACGTCCACACCTTCATCTAATGCCAAGAGGCAGAATCAGCTCCATCC
AAGTTCTGCACAGAGTAGAAGTGGTCAGCCTCAAAAGGCTGCCACTTGCAAAGTTTCTTC
TATTAACCAAGAAACAATACAGACTTATTGTGTAGAAGATACTCCAATATGTTTTTCAAG
ATGTAGTTCATTATCATCTTTGTCATCAGCTGAAGATGAAATAGGATGTAATCAGACGAC
ACAGGAAGCAGATTCTGCTAATACCCTGCAAATAGCAGAAATAAAAGAAAAGATTGGAAC
TAGGTCAGCTGAAGATCCTGTGAGCGAAGTTCCAGCAGTGTCACAGCACCCTAGAACCAA
ATCCAGCAGACTGCAGGGTTCTAGTTTATCTTCAGAATCAGCCAGGCACAAAGCTGTTGA
ATTTTCTTCAGGAGCGAAATCTCCCTCCAAAAGTGGTGCTCAGACACCCAAAAGTCCACC
TGAACACTATGTTCAGGAGACCCCACTCATGTTTAGCAGATGTACTTCTGTCAGTTCACT
TGATAGTTTTGAGAGTCGTTCGATTGCCAGCTCCGTTCAGAGTGAACCATGCAGTGGAAT
GGTAAGTGGCATTATAAGCCCCAGTGATCTTCCAGATAGCCCTGGACAAACCATGCCACC
AAGCAGAAGTAAAACACCTCCACCACCTCCTCAAACAGCTCAAACCAAGCGAGAAGTACC
TAAAAATAAAGCACCTACTGCTGAAAAGAGAGAGAGTGGACCTAAGCAAGCTGCAGTAAA
TGCTGCAGTTCAGAGGGTCCAGGTTCTTCCAGATGCTGATACTTTATTACATTTTGCCAC
GGAAAGTACTCCAGATGGATTTTCTTGTTCATCCAGCCTGAGTGCTCTGAGCCTCGATGA
GCCATTTATACAGAAAGATGTGGAATTAAGAATAATGCCTCCAGTTCAGGAAAATGACAA
TGGGAATGAAACAGAATCAGAGCAGCCTAAAGAATCAAATGAAAACCAAGAGAAAGAGGC
AGAAAAAACTATTGATTCTGAAAAGGACCTATTAGATGATTCAGATGATGATGATATTGA
AATACTAGAAGAATGTATTATTTCTGCCATGCCAACAAAGTCATCACGTAAAGCAAAAAA
GCCAGCCCAGACTGCTTCAAAATTACCTCCACCTGTGGCAAGGAAACCAAGTCAGCTGCC
TGTGTACAAACTTCTACCATCACAAAACAGGTTGCAACCCCAAAAGCATGTTAGTTTTAC
ACCGGGGGATGATATGCCACGGGTGTATTGTGTTGAAGGGACACCTATAAACTTTTCCAC
AGCTACATCTCTAAGTGATCTAACAATCGAATCCCCTCCAAATGAGTTAGCTGCTGGAGA
AGGAGTTAGAGGAGGGGCACAGTCAGGTGAATTTGAAAAACGAGATACCATTCCTACAGA
AGGCAGAAGTACAGATGAGGCTCAAGGAGGAAAAACCTCATCTGTAACCATACCTGAATT
GGATGACAATAAAGCAGAGGAAGGTGATATTCTTGCAGAATGCATTAATTCTGCTATGCC
CAAAGGGAAAAGTCACAAGCCTTTCCGTGTGAAAAAGATAATGGACCAGGTCCAGCAAGC
ATCTGCGTCTTCTTCTGCACCCAACAAAAATCAGTTAGATGGTAAGAAAAAGAAACCAAC
TTCACCAGTAAAACCTATACCACAAAATACTGAATATAGGACACGTGTAAGAAAAAATGC
AGACTCAAAAAATAATTTAAATGCTGAGAGAGTTTTCTCAGACAACAAAGATTCAAAGAA
ACAGAATTTGAAAAATAATTCCAAGGTCTTCAATGATAAGCTCCCAAATAATGAAGATAG
AGTCAGAGGAAGTTTTGCTTTTGATTCACCTCATCATTACACGCCTATTGAAGGAACTCC
TTACTGTTTTTCACGAAATGATTCTTTGAGTTCTCTAGATTTTGATGATGATGATGTTGA
CCTTTCCAGGGAAAAGGCTGAATTAAGAAAGGCAAAAGAAAATAAGGAATCAGAGGCTAA
AGTTACCAGCCACACAGAACTAACCTCCAACCAACAATCAGCTAATAAGACACAAGCTAT
TGCAAAGCAGCCAATAAATCGAGGTCAGCCTAAACCCATACTTCAGAAACAATCCACTTT
TCCCCAGTCATCCAAAGACATACCAGACAGAGGGGCAGCAACTGATGAAAAGTTACAGAA
TTTTGCTATTGAAAATACTCCGGTTTGCTTTTCTCATAATTCCTCTCTGAGTTCTCTCAG
TGACATTGACCAAGAAAACAACAATAAAGAAAATGAACCTATCAAAGAGACTGAGCCCCC
TGACTCACAGGGAGAACCAAGTAAACCTCAAGCATCAGGCTATGCTCCTAAATCATTTCA
TGTTGAAGATACCCCAGTTTGTTTCTCAAGAAACAGTTCTCTCAGTTCTCTTAGTATTGA
CTCTGAAGATGACCTGTTGCAGGAATGTATAAGCTCCGCAATGCCAAAAAAGAAAAAGCC
TTCAAGACTCAAGGGTGATAATGAAAAACATAGTCCCAGAAATATGGGTGGCATATTAGG
TGAAGATCTGACACTTGATTTGAAAGATATACAGAGACCAGATTCAGAACATGGTCTATC
CCCTGATTCAGAAAATTTTGATTGGAAAGCTATTCAGGAAGGTGCAAATTCCATAGTAAG
TAGTTTACATCAAGCTGCTGCTGCTGCATGTTTATCTAGACAAGCTTCGTCTGATTCAGA
TTCCATCCTTTCCCTGAAATCAGGAATCTCTCTGGGATCACCATTTCATCTTACACCTGA
TCAAGAAGAAAAACCCTTTACAAGTAATAAAGGCCCACGAATTCTAAAACCAGGGGAGAA
AAGTACATTGGAAACTAAAAAGATAGAATCTGAAAGTAAAGGAATCAAAGGAGGAAAAAA
AGTTTATAAAAGTTTGATTACTGGAAAAGTTCGATCTAATTCAGAAATTTCAGGCCAAAT
GAAACAGCCCCTTCAAGCAAACATGCCTTCAATCTCTCGAGGCAGGACAATGATTCATAT
TCCAGGAGTTCGAAATAGCTCCTCAAGTACAAGTCCTGTTTCTAAAAAAGGCCCACCCCT
TAAGACTCCAGCCTCCAAAAGCCCTAGTGAAGGTCAAACAGCCACCACTTCTCCTAGAGG
AGCCAAGCCATCTGTGAAATCAGAATTAAGCCCTGTTGCCAGGCAGACATCCCAAATAGG
TGGGTCAAGTAAAGCACCTTCTAGATCAGGATCTAGAGATTCGACCCCTTCAAGACCTGC
CCAGCAACCATTAAGTAGACCTATACAGTCTCCTGGCCGAAACTCAATTTCCCCTGGTAG
AAATGGAATAAGTCCTCCTAACAAATTATCTCAACTTCCAAGGACATCATCCCCTAGTAC
TGCTTCAACTAAGTCCTCAGGTTCTGGAAAAATGTCATATACATCTCCAGGTAGACAGAT
GAGCCAACAGAACCTTACCAAACAAACAGGTTTATCCAAGAATGCCAGTAGTATTCCAAG
AAGTGAGTCTGCCTCCAAAGGACTAAATCAGATGAATAATGGTAATGGAGCCAATAAAAA
GGTAGAACTTTCTAGAATGTCTTCAACTAAATCAAGTGGAAGTGAATCTGATAGATCAGA
AAGACCTGTATTAGTACGCCAGTCAACTTTCATCAAAGAAGCTCCAAGCCCAACCTTAAG
AAGAAAATTGGAGGAATCTGCTTCATTTGAATCTCTTTCTCCATCATCTAGACCAGCTTC
TCCCACTAGGTCCCAGGCACAAACTCCAGTTTTAAGTCCTTCCCTTCCTGATATGTCTCT
ATCCACACATTCGTCTGTTCAGGCTGGTGGATGGCGAAAACTCCCACCTAATCTCAGTCC
CACTATAGAGTATAATGATGGAAGACCAGCAAAGCGCCATGATATTGCACGGTCTCATTC
TGAAAGTCCTTCTAGACTTCCAATCAATAGGTCAGGAACCTGGAAACGTGAGCACAGCAA
ACATTCATCATCCCTTCCTCGAGTAAGCACTTGGAGAAGAACTGGAAGTTCATCTTCAAT
TCTTTCTGCTTCATCAGAATCCAGTGAAAAAGCAAAAAGTGAGGATGAAAAACATGTGAA
CTCTATTTCAGGAACCAAACAAAGTAAAGAAAACCAAGTATCCGCAAAAGGAACATGGAG
AAAAATAAAAGAAAATGAATTTTCTCCCACAAATAGTACTTCTCAGACCGTTTCCTCAGG
TGCTACAAATGGTGCTGAATCAAAGACTCTAATTTATCAAATGGCACCTGCTGTTTCTAA
AACAGAGGATGTTTGGGTGAGAATTGAGGACTGTCCCATTAACAATCCTAGATCTGGAAG
ATCTCCCACAGGTAATACTCCCCCGGTGATTGACAGTGTTTCAGAAAAGGCAAATCCAAA
CATTAAAGATTCAAAAGATAATCAGGCAAAACAAAATGTGGGTAATGGCAGTGTTCCCAT
GCGTACCGTGGGTTTGGAAAATCGCCTGAACTCCTTTATTCAGGTGGATGCCCCTGACCA
AAAAGGAACTGAGATAAAACCAGGACAAAATAATCCTGTCCCTGTATCAGAGACTAATGA
AAGTTCTATAGTGGAACGTACCCCATTCAGTTCTAGCAGCTCAAGCAAACACAGTTCACC
TAGTGGGACTGTTGCTGCCAGAGTGACTCCTTTTAATTACAACCCAAGCCCTAGGAAAAG
CAGCGCAGATAGCACTTCAGCTCGGCCATCTCAGATCCCAACTCCAGTGAATAACAACAC
AAAGAAGCGAGATTCCAAAACTGACAGCACAGAATCCAGTGGAACCCAAAGTCCTAAGCG
CCATTCTGGGTCTTACCTTGTGACATCTGTTTAA
aagagaggaagaatgaaactaagaaaattctatgttaattacaactgctatatagacatt
ttgtttcaaatgaaactttaaaagactgaaaaattttgtaaataggtttgattcttgtta
gagggtttttgttctggaagccatatttgatagtatactttgtcttcactggtcttattt

Predicted peptide sequence(s):


>APC_1|GENSCAN_predicted_peptide_1|301_aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAEFFDTTVYPPVGFNFDPNYPELESAPQVKDKVSHKTVHFKRQPQVLGVPKPPGLLPSC
L

>APC_1|GENSCAN_predicted_peptide_2|117_aa
MQDIIRIVFQIYRLWLIEEGKEKTTMGVIGFEDCEMAPPTLEALNASIIQTDKGMELCIT
LHNLQYDWRSTISATGLPARFDTLKTKEVVVHYYERLILTSFLISIVALQLLQGFLL

>APC_1|GENSCAN_predicted_peptide_3|2587_aa
MVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNS
RGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEPGMDQ
DKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGRKATRGISSQELGQGLSGEEQDG
ASGGVTAGDIATGDYLLLTPHLQICTGAKGGLGWGLQAIAELLQVDCEMYGLTNDHYSIT
LRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRAD
VNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFL
VGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTI
VSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAK
YKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQSLY
GDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERER
GIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCVT
DERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKR
GQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQL
NSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQ
ECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEE
ERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKSSSGQSSKTEHMSSSSE
NTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQTYCVEDTPICFSRCSS
LSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHPRTKSSR
LQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSF
ESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNK
APTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFI
QKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILE
ECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPSQNRLQPQKHVSFTPGD
DMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQSGEFEKRDTIPTEGRS
TDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASAS
SSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNL
KNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSR
EKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQS
SKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQ
GEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRL
KGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLH
QAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTL
ETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGV
RNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSS
KAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTAST
KSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKGLNQMNNGNGANKKVEL
SRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPASPTR
SQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESP
SRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSIS
GTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTED
VWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTV
GLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGT
VAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSG
SYLVTSV