GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:52:23

Sequence WHSC1_1 : 90874 bp : 47.04% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   6693   6867  175  0  1  119   55    88 0.398   8.54
atgagctggaagaggaactgactttgatctacctttttaagaaattgtgcgggtcagaca
gaacacatttgtatgtgttttggtgttaaagagttgtccagagcacatgaagctgaactg
ggacttcaacattttttcaaggttttacatttgctctttttttcctgtctccttcctcag
CTGTCTGCTTTTCTGTGGAGACTGCGGGTTGCAGACACCAGCAGCCCCCTATTGCTGCAC
GTCAGGTGTCCTCCACCTCAGTACTGTGGACATCTCGGGCCGCATAGCCCTGTTGCGCGG
GCATCCTGTGCGTTGCAGGAGATGCAGCAGCATCCATGACCGCAACCCATCAGAG
gtcagggtccgccccctagtggtggtaataaaaaatgcttccagatgaggttaagtgtcc
ctggggaacaaaatcctccccatttgagaaccgctgttctagtccacgggcatctctggt
ccttactgtactcagattttccctagtgtctgatgctattgatttctggcttctcagagg

 1.02 Intr +   8166   8723  558  2  0   38   63   573 0.248  42.83
ttgcttacaaagaaaatcagaccccacaaagctgtagaggtcctggcatacctatcctag
gttttaaatgtaattgctttttctttcttttttcttttttttaataccatagtgttctaa
gaacggaagcatctgggctggatggaatttagcatcaagcagagtcccctttctgttcag
AGTGTTGTAAAGTGCATAAAGATGAAGCAGGCACCAGAAATCCTCGGCAGTGCCAACGGG
AAGACTCCGAGCTGCGAGGTGAACCGCGAGTGTTCTGTGTTCCTCAGCAAAGCCCAGCTC
TCCAGTAGCCTGCAGGAGGGGGTCATGCAGAAGTTTAACGGCCACGACGCCCTGCCCTTT
ATTCCAGCCGACAAGCTGAAAGATCTTACTTCCCGGGTGTTTAATGGAGAACCCGGCGCA
CACGATGCCAAACTGCGTTTTGAGTCCCAGGAAATGAAAGGGATTGGGACACCCCCTAAC
ACTACCCCTATCAAAAATGGCTCTCCAGAAATTAAGCTGAAAATCACCAAAACATACATG
AATGGGAAGCCTCTCTTTGAATCTTCCATTTGTGGTGACAGTGCTGCTGATGTGTCTCAG
TCAGAAGAAAATGGACAAAAACCAGAAAACAAGGCGAGAAGGAACAGGAAGAGGAGCATA
AAATATGACTCCTTGCTGGAGCAGGGCCTTGTCGAAGCAGCTCTTGTGTCTAAGATCTCA
AGTCCTTCAGATAAAAAG
gtatttaggagacgttgtgtaaggggtcatgtgaccttgagcagtgagcatggccaccct
atgagggcacctgcacgagtactggggcgggcggagaaggtgaggacaggcctggtactt
ccagccacttgcctgagccctggctttgggttggagggtgggctccaggatgccctggca

 1.03 Intr +  11688  11850  163  2  1   83   67    -3 0.017  -3.35
agagacaaaattttgatgaaacgatgttgaggctatcatctaaaacacagcaagggagca
cactccatttttgggggtctgtgtgtatttggacattgtagcctggtgaatccttggtct
tctggatacacaggtagtgattggatgtgttagtgtttgtcttctgttgttcattttcag
ATTCCAGCTAAGAAAGAGTCTTGTCCAAACACTGGAAGAGACAAAGACCACCTGTTGAAA
TACAACGTTGGTGATTTGGTGTGGTCCAAAGTGTCGGGTTACCCTTGGTGGCCTTGCATG
GTTTCTGCAGATCCACTCCTTCACAGCTATACCAAACTTAAAG
gtattgtgttctttgggttgtttttccaactttctcttctgcacttaatctttctcatct
ccaggcttctttcttactctttctaaatagccctgctatggttcatttttgcagctttac
ctaaagttagtgattgattcaagtgtgatgtgttgccatttctttttatattcaactcaa

 1.04 Intr +  24343  24509  167  2  2   56   54   138 0.958   6.88
taagttaattagtttccctctttggcatgtggcatggaagggataagaagtatagaattt
gttttgaggttaacaggctcagacaacaccaagggaaacaactgcaaaatagcagtagat
ttgactagtttcatcccagattctaactttcattctctaacattttattttaaaaactag
GTCAGAAAAAGAGTGCACGCCAGTATCACGTACAGTTCTTTGGTGACGCCCCAGAAAGAG
CTTGGATATTTGAGAAGAGCCTCGTAGCTTTTGAAGGAGAAGGACAGTTTGAAAAATTAT
GCCAGGAAAGTGCCAAGCAGGCACCCACGAAAGCTGAGAAAATTAAG
gtgatagatgacccttcagtctacttttagaccagaaatttaatttttattctttaagtt
aacttatttttgttttgaacttatacttgctcgaaatattgtaatggcttaacaatctct
ttcattgttgacttttgcccaaggatgccatgttacaatatgataaagttcttttagaga

 1.05 Intr +  25613  26095  483  1  0   96   78   303 0.224  23.32
agtagagatggggttttgccatgttgaccaggctggtcttaaactcctggcctcaagtga
tccatctgccttgacacccataagtgctggaattataggcatgaatcatgtgcctaggaa
aagtagttaacttttatgtttgtgtagtgaaacttacagtgtctcttttttttttcccag
CTATTGAAACCAATTTCAGGGAAATTGAGGGCCCAGTGGGAAATGGGCATTGTTCAAGCA
GAAGAAGCTGCAAGCATGTCAGTGGAGGAGCGGAAAGCCAAGTTCACCTTTCTCTATGTG
GGGGACCAGCTTCATCTCAACCCTCAAGTAGCCAAGGAGGCTGGCATTGCTGCAGAGTCT
TTGGGAGAAATGGCAGAATCCTCAGGAGTCAGTGAAGAAGCTGCTGAAAACCCCAAGTCT
GTGAGAGAAGAGTGCATTCCCATGAAGAGAAGGCGGAGGGCCAAACTGTGTAGCTCTGCA
GAGACCCTGGAGAGTCACCCCGACATAGGGAAGAGTACTCCTCAAAAGACGGCAGAGGCT
GACCCCAGAAGAGGAGTAGGGTCTCCTCCTGGGAGGAAGAAGACCACAGTCTCCATGCCA
CGAAGCAGGAAGGGAGATGCAGCATCCCAGTTTTTGGTCTTCTGTCAAAAACACAGGGAT
GAG
gtcagtactaagttgtgtttcatgctagcaagtttcagaatttgaggaacatcccttcag
tgcagaatcatctgtttctcagcattatcaggagactctaacatgagccttgcatagatt
ttagatctaataaataagtattagggaacagccattctgacccttgagggaaaagatact

 1.06 Intr +  36886  36999  114  0  0   53   93    92 0.512   6.84
ggaggctataagaagccgtctgtggtgactgtcttgggaggaggggtttgggtttggggg
cagaggttacctgtattggctgggcaggtggtaggtccaggtggtaatggtaaccaacca
acattaacctgatggttccttaccactgccaggtggagtgttactgcccccgtttcacag
AGTGGAGGCAGAGACAGTGCCTTCACTTGCCGAAGTCCACAGAACTACCCAGTAGAGGAG
CCAGCATCAGAGCTGGTTGGTGCCGAGCCAGTCAGCAGACTTTCCAAAGGGCTG
gtgagcagtgagggctctgttctgactgctcagctctgctgttgtggcaggaagacagcc
atgggcagcatgggaacaaatgcatggggctgacatccagtaaaactttgtgggcactgt
tgtttgaatttcctgtaatttttgtgtcatgaaatattatgatgtttttcagacattgaa

 1.07 Intr +  38098  38242  145  0  1  130   57   197 0.898  20.66
gtcacagcatcagttaagcactacttttctttgaagcttttatggacatagttccacgat
gtgggaataaaaatgcgacacactaagttctaaagggccgtgcatttgatttcatgcaaa
acaaaacccaatgagttttacggatttaacttctcattgcaccttctcccgttcccacag
GTGGTAGCTGAGCACCCAGATGCTTCAGGTGAGGAGATTGAAGAGCTGCTCAGGTCACAG
TGGAGTCTGCTGAGTGAGAAGCAGAGAGCACGCTACAACACCAAGTTTGCCCTGGTGGCC
CCTGTCCAGGCTGAAGAAGACTCTG
gtaaacatagcattatgctgatgtcctctgcttgggttgatgtgtgtagtgtagcaagct
gagctctgatcttggaaccgtagggaagtgtgtccactctccctgtttctgacccgtggg
gtttgggccagcggtccaagtgcgtgtggtcacagtaaaaacagcttctgccatctgcgt

 1.08 Intr +  42616  42734  119  2  2   62   86    48 0.514   2.18
gtttttttgttgtaaagagatttgatctgtaagacataagccctggaaatcagcagggtt
acaggaaacccatcatgggctggatctgtatgttgaatgccctgggtaggttctcacagt
gcttcaaatgcagcttttggagtggttttcatgtacattttccccattccccattccaag
GTAATGTAAATGGGAAAAAAAGAAACCACACAAAGAGGATACAGGACCCTACAGAAGATG
CTGAAGCTGAGGACACACCCAGGAAAAGACTCAGGACGGACAAGCACAGTCTTCGGAAG
gtaattgtgttccaggtttgcttgacctgtcagagtgtatgctctgtgactcttggtgcc
actgtttccctgcatgggagcacacatgagatgcaggtgtcagtgcacccagctccttcc
aggctggtattcagcagaaggcttgcatttcttacagaaccccattgagaaaggctgctt

 1.09 Intr +  45923  46004   82  1  1   58   95    74 0.581   4.31
acacatttccaaaggaagaagtttctgccacgaaacttttcagcaacctgtgttcattca
catgaggagattttttttcctttcttttccttttgttgttctttttctttttttttcctt
tttttcttttcttttttttttctttctttttttttttttttttttttttttaaataatag
AGAGACACAATCACTGACAAAACGGCCAGAACAAGCTCTTACAAGGCCATGGAGGCAGCC
TCCTCGCTCAAGAGCCAGGCAG
gtaatgtggtcagcgccctttccttcttggcttctgggtgcccaggctgggctgggtggg
tgggctgagagtgtgaaaggggaaggctggggctggtgaaggggaacagggcaggggagg
aatccacaattaagctaggagtgaaaaagaaggaaaggaggttctcctgtggttgaaaac

 1.10 Intr +  47126  47250  125  0  2   39   83    89 0.534   3.80
tacagtttgtctgcttttgtttatgttcagatttttccatgatagaaagttaagccagaa
ggacaaaggaattcagaagattcatctttagaacttcacttatttgaggggtaattttta
agcagtaaaaagatcaagggtttatgatttgaaactttacaaaccaaaattattttacag
CAACGAAAAATCTGTCTGATGCATGTAAACCACTGAAGAAGCGAAATCGGGCTTCCACGG
CAGCATCTTCAGCTCTTGGGTTTAGCAAAAGTTCATCTCCTTCTGCATCCTTAACTGAGA
ATGAG
gtaaaataataataataacgataaccatggcattggtatgaaggccatttagctgcccac
gctgcagtgtgagtaatgctcagacttcataagcgcagcattggtgctcactgccagtgc
agatgttttagggcctcttggctaactcagattcatgaaatggacaaacagtgcactatg

 1.11 Intr +  58544  58675  132  1  0  122   94   122 0.921  17.04
gttatattatcacaaaaaccagttgatgatggttccactgtgaaatcactggcggtacag
gaccagtgctgagaaagactggtgggtggtggggtggggcgggacgagcctgcctgcagg
gcatggccacccgctgtgttctgcgactagtgaactgtcatccgcctccttcatctctag
GTCTCGGACAGCCCGGGAGACGAGCCCTCGGAGTCCCCATACGAAAGTGCAGACGAAACA
CAAACTGAAGTATCTGTCTCATCCAAAAAGTCTGAGCGAGGAGTGACTGCCAAAAAGGAG
TATGTGTGCCAG
gtgaggagaaggcagcatccgctatgtccgtgctggtgtctgactggggccccggtacgc
agagcgaatttgtagtgtcttttcccttcccaccagaccccttccccaatctcaccgtca
ctcactcatctctgttttgaaggggtcagactgactctcagtggaatcctgggattgagt

 1.12 Intr +  60947  61070  124  1  1   65   86    66 0.909   4.26
tctccaccccttctttaactttttgttagggattcactcatgtttcgtgtgtaaagagag
caagacagatgttaagcgctgtgtggtaactcagtgtggaaaattttaccatgaggcttg
tgtgaaaaaataccctctgactgtatttgagagccgaggtttccgctgccccctccacag
CTGTGTGAGCTGCCATGCTTCCAACCCTTCAAACCCAAGGCCGTCAAAAGGTACAGGTGC
ACCTGCGCAGCCTTGCTGTGGGTTCAGATGCAGGCCAGACGCAGGCCCATGGGCGCTTGG
GAAG
gtgggctgttgggattgtcaccaaagagcattaattatcttgagtgactaactggacatc
ggctgggttgggttttctttgacaaaggacctgtctcccttttccttctttccatcctaa
atatcaccctaaagatgcttaactataggagaggggcaacctttggaccatttgatagat

 1.13 Intr +  62633  62812  180  0  0   90  100   205 0.991  21.74
ttttctcaaacatggttttgaagcacctttgctctgaaagctttttttaaatcaaatacc
tccatttcattttagcattaacttttcaaattcatggaggctgagtaattattagttgct
cttttcactatgactggagtcagtgtttggggtccttagggtgtgtttctttgccttcag
GTAAAATGATGCGGTGTGTCCGCTGCCCCGTTGCCTATCACAGCGGGGATGCTTGTCTGG
CAGCAGGATGCTCAGTGATCGCCTCCAACAGCATCATCTGCACTGCCCACTTCACTGCTC
GGAAGGGGAAGCGACACCACGCCCACGTCAACGTGAGCTGGTGCTTCGTGTGCTCCAAAG

gtgaggggcctgggggtgtctgcggcacacgcctctcacactcccaggagccacatatca
aggcaggctcattccttgtctgcgctgtgttcattgatgttgacagtgttctgtgcgtct
tcacgttaatagtatatcacagtagctctaaattaattgtaatcatttcgcaaacataca

 1.14 Intr +  63165  63321  157  1  1  106   64   102 0.838   8.67
aacatacaggaaattatttgtggtgaaaatgacatttgctctcgtgctgatgtacagatc
gctgttttaaaactgatgtttataagttaaggctgtaataagtgtagactgtgaagcact
gaatctgggctgagccatagcagacaggctaagcctggccgcctcgccctcctcttgcag
GGGGGAGCCTTCTGTGCTGTGAGTCCTGCCCAGCGGCCTTCCACCCTGACTGCCTGAACA
TCGAGATGCCTGACGGCAGCTGGTTCTGCAATGACTGCAGGGCTGGGAAGAAGCTGCACT
TCCAGGATATCATTTGGGTGAAACTTGGGAACTACAG
gtgtgagacatagaatcgtatgcttttatgtcttttctgttcacatgtgttcgctttaca
gtacttaaagtattgaaattattatcgctgtctctgaggagtctgtgaatcctgttttta
atatttataatagatggtggccggcagaagtttgccatcccaaaaatgttcccccaaata

 1.15 Intr +  63455  63660  206  2  2   28   76   170 0.845   8.64
aagctgcacttccaggatatcatttgggtgaaacttgggaactacaggtgtgagacatag
aatcgtatgcttttatgtcttttctgttcacatgtgttcgctttacagtacttaaagtat
tgaaattattatcgctgtctctgaggagtctgtgaatcctgtttttaatatttataatag
ATGGTGGCCGGCAGAAGTTTGCCATCCCAAAAATGTTCCCCCAAATATTCAGAAAATGAA
GCACGAGATTGGAGAATTCCCTGTGTTTTTCTTTGGGTCTAAAGATTATTACTGGACGCA
TCAGGCGCGAGTGTTCCCGTACATGGAGGGGGACCGGGGCAGCCGCTACCAGGGGGTCAG
AGGGATCGGAAGAGTCTTCAAAAACG
gtacggagatattcagatagagagtgagacagcactctcgtgcattttcttacccctaat
ttctattttttaaaatttgatctttatagaaaatactggactaagcattcaatctgtttt
tttaaattaggaaaatgtttgcagtctggtttatttgttgagcatagaataagatacact

 1.16 Intr +  65405  65508  104  0  2   51   38   144 0.990   5.59
cacacttggccgcatttaaaaatacctgcccactgacagttgttcatagactctagtttt
atgggaaccagaaactatacttaacattgaaagtttagagtgaactataaaaatatggag
cttgaaaggtagttacctgtatttactaaaatctttactcctatttcattgactttttag
CACTGCAAGAAGCTGAAGCTCGTTTTCGTGAAATTAAGCTTCAGAGGGAAGCCCGAGAAA
CACAGGAGAGCGAGCGCAAGCCCCCACCATACAAGCACATCAAG
gtggcgtgtgggagctgcgtgcacgcgtgtggagggagtcttccccgagggccgtgagag
gttcttaggcacacccaggctatggctggggagaggactgtcaccagccaggatctgtgg
tgcctggcatggatggccacacaagagaccatgagcaaatggcatggggggatctgcatg

 1.17 Intr +  66943  67212  270  0  0   98   95   399 0.999  39.34
gcagaggagagctcctctgggatctggggagggctgttctgagtagtgtgtcctagccag
gactctgaagctttctaaaaggccacctggaggctgggtaaggagaggcagtggtgggtg
tgcaagggtattcggaaggctctcatgtgtggaccaagacagcttactccttccctgcag
GTGAATAAGCCTTACGGGAAAGTCCAGATCTACACAGCGGATATTTCAGAAATCCCTAAG
TGCAACTGCAAGCCCACAGATGAGAATCCTTGTGGCTTTGATTCGGAGTGTCTGAACAGG
ATGCTGATGTTTGAGTGCCACCCGCAGGTGTGTCCCGCGGGCGAGTTCTGCCAGAACCAG
TGCTTCACCAAGCGCCAGTACCCAGAGACCAAGATCATCAAGACAGATGGCAAAGGGTGG
GGCCTGGTCGCCAAGAGGGACATCAGAAAG
gtatgtgtcgttatcccctcccctgcttttgagaaattacggttcactgggtaattaggc
ctaggtttgcttgtggtggttttgtagtcatgtgagaatggtattttttggaaaaaaaat
tttttttgtttttgttttgagacagggtctcactctgtcatctaggctggagggcagtgg

 1.18 Intr +  68507  68623  117  1  0   49   90   224 0.670  19.36
atacagatatgtctgagatcctttgaatttaatttatggagactttgtacacgccctcca
cggaggtatgctgatgtgtgtggtgcccgttctaagtgatcatgatggggagtcttgagc
cccgacactgaggattggtcagcacgctttttgtcatggccacatgcttgtgatttccag
GGAGAATTTGTTAACGAGTACGTTGGGGAGCTGATCGACGAGGAGGAGTGCATGGCGAGA
ATCAAGCACGCACACGAGAACGACATCACCCACTTCTACATGCTCACTATAGACAAG
gtaatgcggaactccactgtgagcttctgcagtgtgctggacctggagccctgatggtca
cctgtagaactggactttgccctgtggcagcgccagcatttgtctccttagctgcttatt
ttcaaacatctgcacattttcttctgaggtgcagcgtgtctttcagctgcgccggagggc

 1.19 Intr +  69692  69782   91  1  1   68   85    71 0.445   4.37
tcatggaagacagatgtgatgagacctagagagaaagggctgctatggaaataagaatgg
ttccaggaaccttgtcaggtggcccctggggaagctatatcccctacccctgcagtagtg
gggcagcagtggccagtggagcctgctccgggggagcactgggctctgtgtcaatcacag
GTCGTGGGGCTTACACCTTTCAAAGAAGTCAGTGTCATGAAGGACAAAAAGAATCCTGGG
TTAAAAGAGACTAAAGAAGTACCCAGAGGAG
gtgtgtgcttcttgatcagagcctgaatctgggatgaggagctataaagtatgcttttgg
gggcagtgggaaaaattttaatttggacaggaggctgttcttcatgctaaatttcatagg
tatggaaagtgttgtggctgcgcaagagaatgacttgtgatgtgtttagggtcagatgtc

 1.20 Intr +  80880  81058  179  1  2  106   41    70 0.901   3.74
gacatggcgggcaacccacagatgaaaactggcccgataagaaggaagtggcactgggcc
ccgctggtaatggtaggaatgtaggttagacacggtgctgccaggcgtcagaggctgggt
tgtcctgttggcattggtggcatgtcccatgtgcatgccccgtgctgtcctcgtccccag
GGCCCTGCAGAAGTGGTGTGCATGCCAACGTGCACATCAGCACCGCGGCTCAGCGCGTCA
TGACAAAGCATCTGCAGAGGGCAGATGAGCACCCCCACTTCTGTGTTGAAGAGTGGCACT
CTGGGTTGATTAGTGCATTTTATTATTGTGAAAAGCATCTTGCAGAGAACCACATTCTG
gtaccatttctggttttaaagggtggcctgtgtgggtatgtagaaaggacacggggccag
cggtcccagacaggggcaccctgggagattgcaccagggctgggtgcgtgggcagttgtg
tcagaggccgcgtgtgaatagtgactccgaagcctgccgcttcctgggaccatgtttatc

 1.21 Intr +  82335  82476  142  2  1   60   87   182 0.860  15.23
tgtgagcaagagaaacaggactggtttgggggtgtcctgtctcagtggacacaggacacc
acggttttcagtacaacaaggaacacaacttgttcaatgtgctttatgatggtgaaaatt
ccctttaaaaataacatgcgattgctaacacttgaccgaatatatcacttgaccttacag
GACCGTATAATAGACGCTGGCCCCAAAGGAAACTACTCTCGATTTATGAATCACAGCTGC
CAGCCCAACTGTGAGACCCTCAAGTGGACAGTGAATGGGGACACTCGTGTGGGCCTGTTT
GCCGTCTGTGACATTCCTGCAG
gtacaagctctggggaccctgcatggggctcctggctatgggggcagagtggccatcgct
gagggctgcgtggggctggactggaaaggctctgggggaggtgggtgctgatgtggagtc
tcttttggtttgaatatctcttttaccaagcaaaattgaaaggccatgggtcaagccagt

 1.22 Intr +  82766  82872  107  0  2   88  116    72 0.995   9.93
gatgtggagtctcttttggtttgaatatctcttttaccaagcaaaattgaaaggccatgg
gtcaagccagtacagatacaaaaataataagagtatttttgttgacctaatacacgcccc
ttagcttttgaagagaaaggcaggtgtttccaatttggtgtctgtctcctcttctcccag
GGACGGAGCTGACTTTTAACTACAACCTCGATTGTCTGGGCAATGAAAAAACGGTCTGCC
GGTGTGGAGCCTCCAATTGCAGTGGATTCCTCGGGGATAGACCAAAG
gtaaggctgtggcgccctccttccccccaggctctgtgttggcattttgcactcctggag
acctgtgtcccccgtgaacagcggcttcctccaggctggcttgttgccgggacaggtggg
agcaagttccctgctgtgggctggggaggatggctctcaacaaaggccagtggttaagag

 1.23 Intr +  83947  84151  205  0  1   69   72   240 0.575  19.27
tgagtcgagtgagtctaaggatgtctggggagcacgaggaggacactcctctcctctcct
cttagtgttgggcacctgcagagatctctgaagttcctggagtgtagctcgctcttctgc
cctatttgcttcagcctgtgtaattctttccggtgatctgtgcttaattcttgactctag
ACCTCGACGACCCTTTCATCAGAGGAAAAGGGCAAAAAGACCAAGAAGAAAACGAGGCGG
CGCAGAGCAAAAGGGGAAGGGAAGAGGCAGTCAGAGGACGAGTGCTTCCGCTGCGGTGAT
GGCGGGCAGCTGGTGCTGTGTGACCGCAAGTTCTGCACCAAGGCCTACCACCTGTCCTGC
CTGGGCCTTGGCAAGCGGCCCTTCG
gtgggtgtgcagcctcgcggtggcttgcagctgtgtctgtgtggcaggctcctgatggcg
gctgctgccgctcttcctgctgaccgggcctcatctgggtgcaggcacatcaggcgctca
tgcagcgaaggccctgatccagggtggcagagcctttctttgttccaccagccgcacatt

 1.24 Term +  86110  86381  272  2  2  107   43   104 0.493   3.45
ggccctgccagggagcccgcccgggctgtggtagacagtttgtctgcccgtcctgttcgc
tggagccagcactattttgtgttcatttgacctgacagttgtaagtcatcttcaaccacg
ataatgttgaagtcgtgattccatcacttctgtgtgctcacatcttgtgttctgttgcag
GGAAGTGGGAATGTCCTTGGCATCATTGTGACGTGTGTGGCAAACCTTCGACTTCATTTT
GCCACCTCTGCCCCAATTCGTTCTGTAAGGAGCACCAGGACGGGACAGCCTTCAGCTGCA
CCCCGGACGGGCGGTCCTACTGCTGTGAGCATGACTTAGGGGCGGCATCGGTCAGAAGCA
CCAAGACTGAGAAGCCCCCCCCAGAGCCAGGGAAGCCGAAGGGGAAGAGGCGGCGGCGGA
GGGGCTGGCGGAGAGTCACAGAGGGCAAATAG
cgccaggcggccgcttggccggatccaggggcggtgcagggcggccggccctgcctgcgg
gagagggcgagcatgaactggcccggaggacccagctcgagccgccaggacacagacgta
caggcctcctcgggagggagcgcctccccaccactgagccatcctcagcagcgtccgctg

Predicted peptide sequence(s):


>WHSC1_1|GENSCAN_predicted_peptide_1|1472_aa
XCLLFCGDCGLQTPAAPYCCTSGVLHLSTVDISGRIALLRGHPVRCRRCSSIHDRNPSES
VVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFI
PADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMN
GKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISS
PSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKG
QKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPI
SGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMA
ESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRG
VGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDESGGRDSAFTCRSPQNYPVEEPASE
LVGAEPVSRLSKGLVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEE
DSGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAME
AASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSDSPGDEP
SESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCELPCFQPFKPKAVKRYRCTCAAL
LWVQMQARRRPMGAWEGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGK
RHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDI
IWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGD
RGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKV
QIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYP
ETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTID
KVVGLTPFKEVSVMKDKKNPGLKETKEVPRGGPCRSGVHANVHISTAAQRVMTKHLQRAD
EHPHFCVEEWHSGLISAFYYCEKHLAENHILDRIIDAGPKGNYSRFMNHSCQPNCETLKW
TVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLS
SEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKR
PFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASV
RSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK