GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:55:24

Sequence UGT2B28_1 : 16950 bp : 32.71% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1203   1923  721  2  1   86   82   265 0.919  20.74
atccttgagtaaatatgaagtaatcaaactttgtctccttgtcatccatgtactcaggat
gctcctataatatatttactttggattgaaggagttatgttttaacttgattgatttatc
tctgtatataagtatgagaaagaaacagtgacttgaaaagaatgattgcattgcaccagg
ATGGCTCTGAAGTGGACTTCAGTTCTTCTGCTGATACATCTCGGTTGTTACTTTAGCTCT
GGGAGTTGTGGAAAGGTGCTGGTGTGGACCGGTGAATACAGCCATTGGATGAATATGAAG
ACAATCCTGAAAGAGCTTGTTCAGAGAGGTCATGAGGTGACTGTACTGGCATCTTCAGCT
TCCATTCTTTTTGATCCCAATGACGCATTCACTCTTAAACTCGAAGTTTATCCTACATCT
TTAACTAAAACTGAATTTGAGAATATCATCATGCAACAGGTTAAGAGATGGTCAGACATT
CAAAAAGATAGCTTTTGGTTATATTTTTCACAAGAACAAGAAATCCTGTGGGAATTTCAT
GACATATTTAGAAACTTCTGTAAAGATGTAGTTTCAAATAAGAAAGTTATGAAAAAACTA
CAAGAGTCAAGATTTGACATCATTTTTGCAGATGCTTTTTTTCCTTGTGGTGAGCTGCTG
GCTGCGCTACTTAACATACCGTTTGTGTACAGTCTCTGCTTCACTCCTGGCTACACAATT
GAAAGGCACAGTGGAGGACTGATTTTCCCTCCTTCCTACATACCTGTTGTTATGTCAAAA
TTAAGTGATCAAATGACTTTCATGGAGAGGGTAAAAAACATGATCTATGTGCTTTATTTT
GACTTTTGGTTCCAAATGTGTGATATGAAGAAGTGGGATCAGTTTTACAGTGAAGTTTTA
G
gtaagaatttgtttaatcgggaacttgaagatctaacttatttgtgtctttgaagcagag
cttatataaagccataaagtcagggaagtggagtttttggtaagtgaatttatgaaatga
aaatacaagatgatctatcaatctcacaaacattatagaaaagcttaaattataaggtct

 1.02 Intr +   3216   3364  149  1  2   90   92    26 0.952   2.23
atggacaaaatatataatacataaaaatatattattcatatacatgaatatatgtatata
tttttcaaagcacacaaactttacctacatctttgcctacataattctaacccctttcag
aaagttatgtaaagtaattatcttacatcatccactttttcttttctttattcctgtcag
GAAGACCCACTACCTTATTTGAGACAATGGGGAAAGCTGACATATGGCTTATGCGAAACT
CCTGGAGTTTTCAATTTCCTCATCCATTCTTACCAAACATTGATTTTGTTGGAGGACTCC
ACTGCAAACCTGCCAAACCCCTACCTAAG
gtaaacatactttcgttggttttattttgttggcttcgaagtttcagtagaaatgagtct
atagccttcattcaaaatgtttgacttacactgaaagaaagatgggaagtaggtggtgta
aagcagataccaaatagaaactcatgtatatgttaataccatcacatgtatgtgagtttt

 1.03 Intr +   7454   7585  132  1  0   84  116   129 0.982  15.22
gccaactacctcaaacatcttcttgtaaagaacctgagtgattgagtcagttaaaaaata
ttatttactccaataattcctcaaaatacttgattttctctctttaatatttggtaccaa
ttctttagtagtgcctgctgtggtgatactcttttgtgattaaacaattttttttcacag
GAAATGGAGGAATTTGTACAGAGCTCTGGTGAAAATGGTGTTGTGGTGTTTTCTCTGGGG
TCAGTGATAAGTAACATGACAGCAGAAAGGGCCAACGTAATTGCAACAGCCCTTGCCAAG
ATCCCACAAAAG
gtaagataaagtgccttactggtgtggaaaactactgaaagaggctgttaaagtttgaga
tctacacagaaagaatattaaggctagactgaactctttacagccaaatacagtcttaaa
tatcttgtgtagcttccaccgacacaagtcatagttgtgcctcagacttagtggttacat

 1.04 Intr +  10367  10454   88  1  1   63   60    44 0.523  -2.28
atatatctaaatcattataaaagttaagaaaataaaatgtgagtattgtttttacatcaa
tctctgagtagatttatttactaacatcccttgatctcattcctaccctttttacagttc
taacattctataatttttgagttccactcatggaataagatattctctttactgtaacag
GTTCTGTGGAGATTTGATGGGAATAAACCAGATGCCTTAGGTCTCAATACTCGGCTGTAT
AAGTGGATACCCCAGAATGACCTTCTAG
gtaacactctggtgaacaaatactggatatattagtaactgcacattagaatgttaatag
tttatcttgaaacatgcttattgaatatttattataggaaaacaaaaagaacttctttgt
atttattttccagtcctaggggaaaagaatatggtagaattgctggcattttatgatatt

 1.05 Intr +  11294  11513  220  0  1   53   69   201 0.634  11.14
caccacggagacttcaattacatctcctaaacaagtacgtgtttattcctctgaagtctg
aaaagtaatggcaaattagtttaatgtgttatctagaaaacactgtcactttcagagcat
ttcattgtgtatcgcattttattcctatgaataattttgctaaaattcatccaatcctag
GTCTTCCAAAAACCAGAGCTTTTATAACTCATGGTGGAGCCAATGGCATCTATGAGGCAA
TCTACCATGGGATCCCTATGGTAGGCATTCCATTGTTTTGGGATCAACCTGATAACATTG
CTCACATGAAGGCCAAGGGAGCAGCTGTTAGACTGGACTTCCACACAATGTCGAGTACAG
ACCTGCTGAATGCACTGAAGACAGTAATTAATGATCCTTC
gtgagtagaacagtatttttcactaggtggtatttgtagatagcttctcttttcaatagt
gagcatgagtttcatcctttttataagagagtaatcttgaaagaatttaaatgatttaac
caatctgaaatctgctttgttttttatctgttatttaaaaattgtgcttgaatcccatac

 1.06 Term +  15232  15511  280  1  1   85   33   212 0.639   9.33
aaaagtccaatttaaaagcccaactatctatgatgactcaaattaaaatacacaaattct
ctgtcaattctttcaaatttactttgaattatttgacactttaaaagcctttcatagact
tgatacatacaggccagttaacttactttcagtgttggtatctttatttttatccttcag
ATATAAAGAGAATGTTATGAAATTATCAATAATTCAACATGATCAACCAGTAAAGCCCCT
GCATCGAGCAGTCTTCTGGATTGAATTTGTGATGTGCCACAAAGGAGCCAAACACCTTCG
AGTTGCAGCCCGTGACCTCACCTGGTTCCAGTACCACTCTTTGGATGTGATTGGGTTTCT
GCTGGCCTGTGTGGCAACTGTGATATTTGTCGTCACAAAGTTTTGTCTGTTTTGTTTCTG
GAAGTTTGCTAGAAAAGGGAAGAAGGGAAAAAGAGATTAG
ttatgtctgacatttgaagctggaaaaccagatagatgggttgacatcagtttattccag
caagaaagaaaagattgttatgcaagatttctttcttcctgtgacaaaaaaaaaaacttt
tcaaaatctaccttgtcaagtaaaaatttgtttttcagagatttaccacccaggtaatgg

Predicted peptide sequence(s):


>UGT2B28_1|GENSCAN_predicted_peptide_1|529_aa
MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSA
SILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFH
DIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTI
ERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVL
GRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTM
SSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD