GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:04:03

Sequence TRPC3_1 : 56578 bp : 36.80% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1655   2386  732  1  0   66  121  1138 0.503 107.72
cggtatcgctagcaactgagccgacccctgcagccagaggtttgcagtgggtagtgtgta
ttccagaaagggccctgacatgtgaaaggaaggaatgtgccctaatattctacagttgtt
ttatcgttgctactgattaggtccatggagggaagcccatccctgagacgcatgacagtg
ATGCGGGAGAAGGGCCGGCGCCAGGCTGTCAGGGGCCCGGCCTTCATGTTCAATGACCGC
GGCACCAGCCTCACCGCCGAGGAGGAGCGCTTCCTCGACGCCGCCGAGTACGGCAACATC
CCAGTGGTGCGCAAGATGCTGGAGGAGTCCAAGACGCTGAACGTCAACTGCGTGGACTAC
ATGGGCCAGAACGCGCTGCAGCTGGCTGTGGGCAACGAGCACCTGGAGGTGACCGAGCTG
CTGCTCAAGAAGGAGAACCTGGCGCGCATTGGCGACGCCCTGCTGCTCGCCATCAGCAAG
GGCTACGTGCGCATCGTAGAGGCCATCCTCAACCACCCTGGCTTCGCGGCCAGCAAGCGT
CTCACTCTGAGCCCCTGTGAGCAGGAGCTGCAGGACGACGACTTCTACGCTTACGACGAG
GACGGCACGCGCTTCTCGCCGGACATCACCCCCATCATCCTGGCGGCGCACTGCCAGAAA
TACGAAGTGGTGCACATGCTGCTGATGAAGGGTGCCAGGATCGAGCGGCCGCACGACTAT
TTCTGCAAGTGCGGGGACTGCATGGAGAAGCAGAGGCACGACTCCTTCAGCCACTCACGC
TCGAGGATCAATGCCTACAAGGGGCTGGCCAGCCCGGCTTACCTCTCATTGTCCAGCGAG
GACCCGGTGCTTACGGCCCTAGAGCTCAGCAACGAGCTGGCCAAGCTGGCCAACATAGAG
AAGGAGTTCAAG
gtaagctttgcgctctaccccggctgctctgtgtgctcacccaacttccccgctgctgcc
tggcctgctctgccaccgttcgctccacattcggttttgcccagtgaatgtgaaatcacg
agggactgagaacgtcattcagacctcatctaatgttttctttctccctctcaatgatgg

 1.02 Intr +   9451   9639  189  0  0   64  113   249 0.953  23.86
tggctaaagggttgggtgggtgcaaatccagcctgtattcagctcaacaagccttgcatc
caggtgggctgcagctttctacccccaaaagaagggatacctttttctaattcacccaaa
tactttccactgaataaaagcaaattatttgtgttaaaacactaaacctcttgttcttag
AATGACTATCGGAAGCTCTCCATGCAATGCAAAGACTTTGTAGTGGGTGTGCTGGATCTC
TGCCGAGACTCAGAAGAGGTAGAAGCCATTCTGAATGGAGATCTGGAATCAGCAGAGCCT
CTGGAGGTACACAGGCACAAAGCTTCATTAAGTCGTGTCAAACTTGCCATTAAGTATGAA
GTCAAAAAG
gtgagtgggcctactttcatctagtgccatattagaataaacatgtgatacaaactatgc
cataatcctaggaaaattattaaaataataagactagacgctagtaggctgggcaacata
atgagactgtgtctgtacaaaaaagaaacaaaattagctgggcatgatggcatgtgcctg

 1.03 Intr +  19713  19877  165  2  0   95   42   190 0.999  14.34
aattttgaaaaatggagggaaagctaagaagaatattaccagaaccttccagtaccaata
tgctagaaaaaatatgctttaatatctttaggatgcatgtgtatttaatagttgagctat
tgacaatggtatggtaacttacctttctctccccttctcaaactctctctctcccaatag
TTTGTGGCTCATCCCAACTGCCAGCAGCAGCTCTTGACGATCTGGTATGAGAACCTCTCA
GGCCTAAGGGAGCAGACCATAGCTATCAAGTGTCTCGTTGTGCTGGTCGTGGCCCTGGGC
CTTCCATTCCTGGCCATTGGCTACTGGATCGCACCTTGCAGCAGG
gtacttgctttctacatctatttcctctgtggtggtgtactgtgtctctttgggataaaa
aaataaaaagcttcatgcttaagaatcttatcagttttaccctgaatgttaattgattca
agaacacagattctcctttttaattactggatcaattcaaataagggatgaaaaaggatt

 1.04 Intr +  22564  22780  217  0  1   80  111   101 0.999   8.75
tatttttggaggaagcattcccctaaaaaagaatatttttcataatataaagctttttgg
aaacagaagcagaattttgagtgttctcctttcatctattttttttaatcctatgttgta
atctccacaagtgaaagccagattttctgaagcaaacttttcctctttggtttgttacag
CTGGGGAAAATTCTGCGAAGCCCTTTTATGAAGTTTGTAGCACATGCAGCTTCTTTCATC
ATCTTCCTGGGTCTGCTTGTGTTCAATGCCTCAGACAGGTTCGAAGGCATCACCACGCTG
CCCAATATCACAGTTACTGACTATCCCAAACAGATCTTCAGGGTGAAAACCACCCAGTTT
ACATGGACTGAAATGCTAATTATGGTCTGGGTTCTTG
gtaagtcttttattttaaatatcctaatttctaccaaaaggtaattatagaaataattgt
cattttctattgaaaaaaaatgttattatatcttatatggtgacaacatcactgttgcaa
gataagctaaatagcaaaataaccaaataattttctagctagataatgccaaaaggtgtc

 1.05 Intr +  24270  24503  234  1  0   90  115   140 0.978  13.64
tcttccatttaactctgcacagggcctcagtgaccatacagtcagtcagtcaatgctttg
tgatgcctagtactgtgcttgacgtgtagggtagagatgtgacctgatggtggacacaat
aatggcttctcagtctggcctgtaaaatctgacctgcaccctctgtatttgttgtgacag
GAATGATGTGGTCTGAATGTAAAGAGCTCTGGCTGGAAGGACCTAGGGAATACATTTTGC
AGTTGTGGAATGTGCTTGACTTTGGGATGCTGTCCATCTTCATTGCTGCTTTCACAGCCA
GATTCCTAGCTTTCCTTCAGGCAACGAAGGCACAACAGTATGTGGACAGTTACGTCCAAG
AGAGTGACCTCAGTGAAGTGACACTCCCACCAGAGATACAGTATTTCACTTATG
gtaagttgttagcttcagggtccccttgtgttttgggaaaggtattggaaccacattttg
gaaggaaatgccaattggagtatgtttagtatgagaggtgtattgaatatttatggacag
tggagaaagcatgaactttggaacctacaaaactggattcatttcaaggctctgaccccc

 1.06 Intr +  27090  27354  265  1  1  121  113   111 0.986  12.55
gaatttacgtttctggtttaagatgaaaatagtccctggacagttaattaaatctagatt
agtttcaactgagatggtaaccacctacctacaagatagatcctatttaaggtatttgct
ttgcgtagttggcaatgaatagaaagctccatttttaatctctttctctcttttttctag
CTAGAGATAAATGGCTCCCTTCTGACCCTCAGATTATATCTGAAGGCCTTTATGCCATAG
CTGTTGTGCTCAGCTTCTCTCGGATTGCGTACATCCTCCCTGCAAATGAGAGCTTTGGCC
CCCTGCAGATCTCTCTTGGAAGGACTGTAAAGGACATATTCAAGTTCATGGTCCTCTTTA
TTATGGTGTTTTTTGCCTTTATGATTGGCATGTTCATACTTTATTCTTACTACCTTGGGG
CTAAAGTTAATGCTGCTTTTACCAC
gtaagtaaaatatcttattatacaggtatgataaagagaaattctaaccaatctagagga
agcaaaggaaaaatttctctgattgtaataaagatgtttttaagcacagaaaataatcca
tcaaaaacagttagtgcttgtgttgattatattgctctgaaggctcatctctgagcttag

 1.07 Intr +  30140  30335  196  2  1   78   84    62 0.968   3.30
gaaaacctgaaagaataatttttctatgaaatgtcataacaaagtaatcctgctcttgga
gtatattatggtggcattttacatctgtacagtagttaaaccctaacttgttttttactt
ttcactcttagatattgaaaactgttaacttacttactttgtatcttattttttcaacag
TGTAGAAGAAAGTTTCAAGACTTTATTTTGGTCAATATTTGGGTTGTCTGAAGTGACTTC
CGTTGTGCTCAAATATGATCACAAATTCATAGAAAATATTGGATACGTTCTTTATGGAAT
ATACAATGTAACTATGGTGGTCGTTTTACTCAACATGCTAATTGCTATGATTAATAGCTC
ATATCAAGAAATTGAG
gtaaatcggttttctatccatagtatctatccttgtcatcctattctgatagtacacatc
tgcttctgtaccctgtggctgagctccagctcatgtaacaaagaggcttatatccacaca
gagcctgagcctttccctgtgttttctacctggatagatagctctacacattctgctgtc

 1.08 Intr +  31011  31112  102  2  0   91   52    39 0.508   0.05
agtatctttttagtgctttgcagtttgttaactccaccaaatctctatgtatgttttaga
aactcataatatagtgttctcaaagtagaagttttggtcctaatggccttctaggctgtg
tgaactgagagagccagcttcctcctcataaggaccccttcccttcatttctcctatcag
TTAGGGTGGTTATCTCCATCACCGTGGGCAGCACAGAGAATGGAAGGAGATGTAAAACAA
GTTCAGGCACTCAGGGGCTTATGTGACATTTGGGGACATATG
gtaaacacagaaatgccgaaaagcaattcatctgagaatcatttttccccttgcccttga
aatataatatgctgtgtctacagcctggcttggataggtataggtgaggaaggaggatgg
gaaataggcaactattgtcaaacatgcagaattgactgggtgggggacagagggaggaat

 1.09 Intr +  31596  31805  210  2  0   81   73   122 0.939   8.19
agtatcttatatttgaaaaatgagaatattgtgtaggtctatagaatatatgtagataaa
tgtgtataagttacctatttcaaaaacgtaacttagattcattgtaaaaaacctattagc
aacagtcactagaatatttagcatttaaaattagtttttttttctatttttgtgacacag
GATGACAGTGATGTAGAATGGAAGTTTGCTCGTTCAAAACTTTGGTTATCCTATTTTGAT
GATGGAAAAACATTACCTCCACCTTTCAGTCTAGTTCCTAGTCCAAAATCATTTGTTTAT
TTCATCATGCGAATTGTTAACTTTCCCAAATGCAGAAGGAGAAGGCTTCAGAAGGATATA
GAAATGGGAATGGGTAACTCAAAGTCCAGG
gtaggtatcgaaaacttaccaagaccttaaaataaatgttctgtcttttttttcttgtct
tctgatgtttgttcaataatttttatgtgtgaacttagaagatgttaaaagtaactgtct
agtccacagtctttcacagactaatactaaatattttcatgatgtttcaagaagtcactg

 1.10 Intr +  42693  42882  190  2  1   37   94   118 0.408   5.54
aactatgaagaaaatcaatatccgtgttttatttacaccattttcccccttcctctccca
gctcctgcttgttaaattattagaactgtgtttgttgggggaagaagaataattttctta
atccctttaggttcagtacctgggggctatgaattaaactgacaactgactgataaacag
GAGGGGAAAAAAGGATTATTTATGCATGCAGTGCACATACCTGTAGAAAAACTCAGTGAT
GAGTGGCTCAAAGGAGTAGTTGGCATTTGGGGCTTATATACCAACTTAACAAGGGACAAG
AAGTTTGTGGAGAAGGGATATGACAAAGGAAAAAGTGTTTGGGTTGCTAAAGGTAGTAAA
TTGTTGGAAG
gtaaatatgtgggagaaactgatagaagatacaggttattttagtaaggtttgcttgtgc
agaaccaccttggtgctgactttctgtccccagtggtaatgattgtttttcctcctgcta
atctgggagggggagaggaagaagatcttcacaaagggaaatgtatgtcctgtttttagg

 1.11 Intr +  50631  50752  122  1  2   29   75    61 0.059  -1.81
tcataagaatagcttcatactctgtggtcttctgcaactggaatttttcattcaacatta
tgcttctaagattcatccacactgttgtgtgtggctatggtgcattaatttcattaatga
acacaataacattacattgaaaatactgcaatttgtctattcttgttaatatttgtttag
ATTGTTTCCAGTGTTTTGCAATTTCAGACAGGGTTGCTACAAACATTGTTGTATGTCTCT
TGGTTCATACCTACAAAGTTTCTCTAGGCCTTTTACTGAGAAGTGGACTTCTAGCTGAAA
GG
gtatgtaaatgttcaactttaaaagataataccacctggatgcagtgggtcatgtctata
gctccagctgcttgagaggctgaggcaggaggacagcgttgagcccaggagtttgaggca
agcctgtgcaatatagtgagactccacctctaaaattttgttaatagaaatcaatttaaa

 1.12 Intr +  52228  52303   76  0  1   44  121   119 0.166   8.97
tcagtagaaggcattaagagagttaagttctgaaacctgcgtaatttttctatacatagt
tataaaatttttttctcccctgagttgtttgctttacaggtatgtaagcctctttggaaa
ataggattggggcacttatgtatatcattggagatctaatcatttacttttgcccaacag
CAGATAATGAAAAGACTTATAAAGCGGTATGTTTTGAAAGCACAAGTAGACAAAGAAAAT
GATGAAGTTAATGAAG
gtaagcatctccaacttaaaaaatatccttttatagctaacttaatgaacctggaaaact
taatgttgaggcatattttaaaaatccaatcccaggttatagtttggatgcctctaagat
gggaggaggatcttatgttacgtttctaaaacttcatcttttaaaataaacagttattta

 1.13 Term +  54779  54921  143  0  2   42   44   109 0.867  -0.99
caaaggtcagtgtacctttaaagacagatgtttcttaaatattttaaagaaaaaactttg
aagtagctaccttggagaccttatgaagcaaatacattgatattgtaagaatttcactct
ttgttcatttctaaatccaaagagcaacttaccaataattttttaatatcaatactatag
GTGAATTAAAAGAAATCAAGCAAGATATCTCCAGCCTTCGTTATGAACTTTTGGAAGACA
AGAGCCAAGCAACTGAGGAATTAGCCATTCTAATTCATAAACTTAGTGAGAAACTGAATC
CCAGCATGCTGAGATGTGAATGA
tgcagcaacctggatttggctttgactatagcacaaatgtgggcaataatatttctaagt
atgaaatacttgaaaaactatgatgtaaatttttagtattaactacctttatcatgtgaa
cctttaaaagttagctcttaatggttttattgttttatcacatgaaaatgcattttattt

Predicted peptide sequence(s):


>TRPC3_1|GENSCAN_predicted_peptide_1|946_aa
MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDY
MGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKR
LTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDY
FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIE
KEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLA
IKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPC
SRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFL
QATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSR
IAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFT
TVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINS
SYQEIELGWLSPSPWAAQRMEGDVKQVQALRGLCDIWGHMDDSDVEWKFARSKLWLSYFD
DGKTLPPPFSLVPSPKSFVYFIMRIVNFPKCRRRRLQKDIEMGMGNSKSREGKKGLFMHA
VHIPVEKLSDEWLKGVVGIWGLYTNLTRDKKFVEKGYDKGKSVWVAKGSKLLEDCFQCFA
ISDRVATNIVVCLLVHTYKVSLGLLLRSGLLAERQIMKRLIKRYVLKAQVDKENDEVNEG
ELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE