GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:51:37

Sequence TACC3_1 : 26029 bp : 56.99% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -    499    295  205  1  1   85   85   446 0.950  42.99
 1.00 Prom -    670    631   40                             -14.13

 2.01 Init +    753    871  119  2  2   67   75   121 0.294   6.33
ggacctgtcggttgcggcggccgccgcccggccgcccgcggggcactctaggacatggag
tcccgccgcccggccgcccgcggggcactctaggacatggagtcccgccgcccggccgcc
cgcggggcactctaggacatggagtcccgccgcccggccgcccgcggggcactctagggc
ATGGAGTCCCGCCGCTCGGCCGCTCGCGGGGCGCTCTGGGAGATGCAGTCCCCGTGCGGG
TGCGGCCTCTCTTCTCGGCCGGCCCTGGAGGCGGCACCGCACCTGTGCATTGAGCACAG
gtggggaaacttaggcctgagcgaggccctggccatgaagccccgcccagtagcgtcagt
tgcggaactcgaaattcatggggcgactgcgagcccggggtctcagcttcagacaccctg
gcgtgccctccactccggaaacggaaccgtcggcgcccgagcggggggtggggggggagg

 2.02 Intr +   3083   3245  163  2  1  104  115   125 0.982  17.29
atggggactcagtctgaggctttctctgccaagagacacgtgtgggaggtgtgagttcca
gagcaatgagcacacctgtgtgggaagtggtcgtgccccttgcagcagctgtcacgtctg
tgtctggacaatgtggtagtgttgccctcacactgacacaaacatgttctgcttttccag
AATGAGTCTGCAGGTCTTAAACGACAAAAATGTCAGCAATGAAAAAAATACAGAAAATTG
CGACTTCCTGTTTTCGCCACCAGAAGTTACCGGAAGATCGTCTGTTCTTCGTGTGTCACA
GAAAGAAAATGTGCCACCCAAGAACCTGGCCAAAGCTATGAAG
gtaagtgtgacctgtacagtgtgtggctggccaggttgccctagggcctgctttcttggt
gacctctgagctgcaggacactgctggtgtggctgtaacagcttgaactaatgaataggt
gctctcctcctcactccgcaacaggtgacttttcagacacctctgcgggatccacagacg

 2.03 Intr +   5431   5580  150  0  0   18   36   141 0.389   2.77
atcccctgcctctcccctatgcctccaggatcacccagcagcctccatagggcagagggt
gtagaggagctgggaggggcttgagaggttggccctgaggggctccagccagagtgactc
tgagcttgtggcttggactcgtggctgtcatctcctttctggaactctgctgaggcccag
GTGGTGGTCACTGTGGTGCTCCCACGTCAGTGGGATGAGACCAAGAGCAGCCGCTGCGTG
CAGCTGCCCACGTGTCATTCAGAGGACAGCCGAGTGGCCGCCTGGGAAGGCAGTGCCGCC
CCAAGGTGGCAGCTGGGCAGCAGAGGAGTT
gtgagcagtctgacaggtccctcaccctcagtttctcagttttgacatcttcaaacttag
agttggaagagaagggcaggtgacatgggccccttatctgaggcactggcacatgaccct
gcgtcttctcagggacctgaaggctggggaacaggtgaaacagtgtttgtgccctctgtg

 2.04 Intr +   5767   5858   92  0  2   69   94    75 0.886   5.49
agtctgacaggtccctcaccctcagtttctcagttttgacatcttcaaacttagagttgg
aagagaagggcaggtgacatgggccccttatctgaggcactggcacatgaccctgcgtct
tctcagggacctgaaggctggggaacaggtgaaacagtgtttgtgccctctgtgttgtag
TCCAGCCCCAACCATCCCAACAGCCGCCTCTTCTGTCAGGGGCCCTGCGCCATGCAGTCC
CACATTGTGAGCAGCGAGTGCCCCAGAGACAG
gtgggtccctgggaaggtgttctctgcacctgtgccactccactgtagcaggcgccatcc
cagggaggcgtcgcagaggccactcaggtccttctgtgcctgcaggtggcatcctgcacc
tcagccctgcccttcagtgaaggctttgactgtccctggccacagcactgccagtccccg

 2.05 Intr +   7370   8449 1080  2  0   15  100   679 0.915  51.78
ggacaggaaggaactacattgaggaactgaggtggggggtggagaacgggaagccgtgcc
aagggtgactcagccctgcttctggtgtgagaatgttaaacctatgttgagaatgaatgc
tgaggcccctaacctcaccaggtactcgctgcttcacgttgattaagtctcttttaaaag
CCAACAGCTCATCAAGGAAGTGGATGCCAAAACTACTCATGGAATTCTACAGAAACCAGT
GGAGGCTGACACCGACCTCCTGGGGGATGCAAGCCCAGCCTTTGGGAGTGGCAGCTCCAG
CGAGTCTGGCCCAGGTGCCCTGGCTGACCTGGACTGCTCAAGCTCTTCCCAGAGCCCAGG
AAGTTCTGAGAACCAAATGGTGTCTCCAGGAAAAGTGTCTGGCAGCCCTGAGCAAGCCGT
GGAGGAAAACCTTAGTTCCTATTCCTTAGACAGAAGAGTGACACCCGCCTCTGAGACCCT
AGAAGACCCTTGCAGGACAGAGTCCCAGCACAAAGCGGAGACTCCGCACGGAGCCGAGGA
AGAATGCAAAGCGGAGACTCCGCACGGAGCCGAGGAGGAATGCCGGCACGGTGGGGTCTG
TGCTCCCGCAGCAGTGGCCACTTCGCCTCCTGGTGCAATCCCTAAGGAAGCCTGCGGAGG
AGCACCCCTGCAGGGTCTGCCTGGCGAAGCCCTGGGCTGCCCTGCGGGTGTGGGCACCCC
CGTGCCAGCAGATGGCACTCAGACCCTTACCTGTGCACACACCTCTGCTCCTGAGAGCAC
AGCCCCAACCAACCACCTGGTGGCTGGCAGGGCCATGACCCTGAGTCCTCAGGAAGAAGT
GGCTGCAGGCCAAATGGCCAGCTCCTCGAGGAGCGGACCTGTAAAACTAGAATTTGATGT
ATCTGATGGCGCCACCAGCAAAAGGGCACCCCCACCAAGGAGACTGGGAGAGAGGTCCGG
CCTCAAGCCTCCCTTGAGGAAAGCAGCAGTGAGGCAGCAAAAGGCCCCGCAGGAGGTGGA
GGAGGACGACGGTAGGAGCGGAGCAGGAGAGGACCCCCCCATGCCAGCTTCTCGGGGCTC
TTACCACCTCGACTGGGACAAAATGGATGACCCAAACTTCATCCCGTTCGGAGGTGACAC
CAAGTCTGGTTGCAGTGAGGCCCAGCCCCCAGAAAGCCCTGAGACCAGGCTGGGCCAGCC
AGCGGCTGAACAGTTGCATGCTGGGCCTGCCACGGAGGAGCCAGGTCCCTGTCTGAGCCA

gtaagtgtgaggatgggatggggagcgtggcgtggggcagctgccctgcagtgtatgtgg
tccaggacccgaggccagaagtgtcatcagatactcctttgaggccgggtaggttctgcc
tgaggaggggcctctggataaaaacagggctcaggtggctcccagctgagggtgcttggc

 2.06 Intr +  10549  10624   76  1  1   87  116    34 0.915   6.11
ggtgaggcagttttgtggccaggtcgcttgggacagccccatgcctggcacgctctagct
gaatgttcacgtggccggcacagcagtgcagggaaaggcgatggcagctcagtgctggag
caggggacgccggggttatggggtggggggcatgggcctctgctgactctgtctccccag
GCAGCTGCATTCAGCCTCAGCGGAGGACACGCCTGTGGTGCAGTTGGCAGCCGAGACCCC
AACAGCAGAGAGCAAG
gtaaggggtgcttgtgtgggtacctgtgctcctggcctggtcgtgtagaagagtagcagg
cagtggaagcccccagcagccttgggtgacggggtgggatgtcccgctccctctccccca
agtctacttcaacaaggttgtggggaggcaaagccacaccccaagtaccttgactgcact

 2.07 Intr +  10834  10963  130  0  1   77   83    22 0.628   1.37
tcctggcctggtcgtgtagaagagtagcaggcagtggaagcccccagcagccttgggtga
cggggtgggatgtcccgctccctctcccccaagtctacttcaacaaggttgtggggaggc
aaagccacaccccaagtaccttgactgcactgcacagggtgactctgccctttcctccag
GAGAGAGCCTTGAACTCTGCCAGCACCTCGCTTCCCACAAGCTGTCCAGGCAGTGAGCCA
GTGCCCACCCATCAGCAGGGGCAGCCTGCCTTGGAGCTGAAAGAGGAGAGCTTCAGAGAC
CCCGCTGAGG
gtacgttgcctggcacagacgtcacacacagtctgcccggaggggatcccgtgagcactt
gggcagctcgagacacctgcatcatcggcaggtggtcatttcgcaggcagttgggtccct
tgactttgaatgactcatgcacaaacttgtggtttgtcaaaacttagtcagtgttaggag

 2.08 Intr +  14941  14987   47  2  2   74   86    57 0.669   2.72
ccaggaggcgcctgccgcagacagcagtcaggccccgaacatccacacctccaagggagg
aaatactgctggctggaatgatcctgcctcactgagtgctgagggagacaccagcccgcc
gcccttagggccctggtgaggggcgatggcggcggcatgattcactcctctcagttctag
GCACGGGCGCGGAGGTGGATTACCTGGAGCAGTTTGGAACTTCCTCG
gtaggtaccaggcaattccgcgaagcctcacccacagggtgtccgagagcagccacggca
ggtcttgcccccggagcgtcccttggtgcccacgtccccccagctgcacacaggcccagg
cattgtggcgggctgtgaatccagggccccttctgcagcacctcctctaagtggtgtcct

 2.09 Intr +  15393  15496  104  2  2  112   91    82 0.816  10.37
aaactctgacacgctgtgctgctgggaatggtggtgtctcgggcagggttgtgggtgacc
gggggtgggagtgtgcgggtgaccgggggtgggagtgtgcaggtgacctccctggccctt
agcccccgtgtgtgttaggggatggcagtcagacctgatcacttgccctcttgtccccag
TTTAAGGAGTCGGCCTTGAGGAAGCAGTCCTTATACCTCAAGTTCGACCCCCTCCTGAGG
GACAGTCCTGGTAGACCAGTGCCCGTGGCCACCGAGACCAGCAG
gtatgtgcgccggccctccctcatgcatgaagccttgagtgtgggaagactggaggctgt
tcctaggtgtgctgtctgcacagaggcttctagaccggggggagatgatcagaactggaa
aggagctgtgctaggggtgggctgggcagcaaggccagagcagcccttgtgtgtctggca

 2.10 Intr +  16903  16990   88  1  1   61   95    48 0.968   3.27
cacggagcagcagagaggccgggcatgctggatgcgggtctgcgttttctaccactaccc
tgacttgagtggttttaaactaaaaagcaaagagcccggttagcttgtccacatggtcct
ctgtgtcctactcaacactgggagggcctagtgactgaggctgcctctgcttggtggcag
CATGCACGGTGCAAATGAGACTCCCTCAGGACGTCCGCGGGAAGCCAAGCTTGTGGAGTT
CGATTTCTTGGGAGCACTGGACATTCCT
gtaagtccttgagtccctcttgaactgtcttgtgtgtggtctgagggaacgagttgtttt
aagggcctatattttctattcctgggggtctgagcctttggttttgttgggggcatgggg
ccgctgtgctgttccctcgccgcactgtctcgggtccctcatgcactgtctgaggctctt

 2.11 Intr +  17260  17364  105  0  0  117   79   115 0.827  14.41
ctgagcctttggttttgttgggggcatggggccgctgtgctgttccctcgccgcactgtc
tcgggtccctcatgcactgtctgaggctcttggcctgtgtgggcctttcctccctcacac
taggtcagaggtaagaggcaagggcgaaatgggttcctgtttcatccccatctcccgcag
GTGCCAGGCCCACCCCCAGGTGTTCCCGCGCCTGGGGGCCCACCCCTGTCCACCGGACCT
ATAGTGGACCTGCTCCAGTACAGCCAGAAGGACCTGGATGCAGTG
gtaaggacgcaggtagtagctattccacagaacctgcaggccgctctggggcttggccaa
cagtgggcaggggtccaacagcctgacccgccatccctgccatccctgcccctgctggtt
ggggtggaattgcagagagctgccggcccctggcctgtcactactgcccaggtcgctgag

 2.12 Intr +  19364  19440   77  1  2   37   74   114 0.954   3.71
ggagcaggtggccttggcctcgacagggttcccagggtcccactggaagccccacatgga
actgtgcctctgggacattgctccagggacctcgggtgcgggctggccccatcctgtggg
gaggtcctgggagggtcagtctggcccgcctgcctgctgacttgggtgtggcctgagcag
GTAAAGGCGACACAGGAGGAGAACCGGGAGCTGAGGAGCAGGTGTGAGGAGCTCCACGGG
AAGAACCTGGAACTGGG
gtaaggaggccccgtctcctgtcctccccgtccccatccccctcgccatccttgtcccca
tccccctcgccatccttgtccccatccccctcgccatccctgtccccgtccccatcccca
cctggcctgggaccgctgggcacccgaggcaatggctgtgtgtctgttctcctcccacag

 2.13 Intr +  19621  19664   44  1  2  112   92    42 0.996   5.37
gtaaggaggccccgtctcctgtcctccccgtccccatccccctcgccatccttgtcccca
tccccctcgccatccttgtccccatccccctcgccatccctgtccccgtccccatcccca
cctggcctgggaccgctgggcacccgaggcaatggctgtgtgtctgttctcctcccacag
GAAGATCATGGACAGGTTCGAAGAGGTTGTGTACCAGGCCATGG
gtgagtgcccgggccaccgaggccacgtgcctccacgaggggctgcctatgccccaccct
ggccctgccctgcaccctgcctaggaccccaccctcctgaggccccttttcctaacacac
gagtcccttcaacatgggcccggccgtggaagcactgaggcgagttgcggggaagctggt

 2.14 Intr +  20488  20648  161  2  2   87   95   269 0.986  27.72
gggctttgcatccggcctagaagatcctgggtggagggacccatcaccctccgaggctca
cacccactgcccacctctcctcctggcgctcgagtcccttgcctcattccttgggctgtc
tctggcacccatcgtttcggttgcctcctcatcctgaacgtttgcttttcttttctcaag
AGGAAGTTCAGAAGCAGAAGGAACTTTCCAAAGCTGAAATCCAGAAAGTTCTAAAAGAAA
AAGACCAACTTACCACAGATCTGAACTCCATGGAGAAGTCCTTCTCCGACCTCTTCAAGC
GTTTTGAGAAACAGAAAGAGGTGATCGAGGGCTACCGCAAG
gtatgtctccgccaccctggtgtcctcacctcggaggctgatggactcatggtccaagcc
agcggggctacaagctgctgtctttgcaccttggtccttggccaagcctccccttgccac
gggggcatgggatgacctgtgaacgagacagggtgcaggagtcacagcatagctggtttg

 2.15 Intr +  21192  21296  105  2  0   25   61   101 0.744   2.01
ttggggacccagggcatgcagtatccaaggcgggaggcccactgaaaggtggtcacggct
gtgcaaggccaccctggtgtcctcctggccacgggactctgagcgccccccaccttctgt
gctgggcaaggcccacatgcttgctggaaggagggatgtctgggccatccatctgcccag
AGCAGGCCTGGAAGGTGCCTGCGAGGCCGCCAGAGGGTTCTGCCCACAGCAGCAATGTTG
GAGCGGAGGTGCTCAACGCCTCCTGTGGAGGAGCTGGACCTGCAG
gtgcagctggaagaggggctgtcactgttggtgcaagggggttggggacaccagatgggt
cccctgggagtcagactaaactggaaaagcggcccttgcagggcctgctgagccacacct
catctgagtcctgaagtcaggtgggtgtcagtggctggggcccagctgcctaacagaagc

 2.16 Intr +  24180  24286  107  2  2   71   68   153 0.999  11.11
tccagagggggtgagctgggaacttgtgtgaaggggctttttccaaaaggaaaacgggag
ctactggctcacggctgatgccccagacagcctcgaggatctgcaggtccccagacacca
agcctgggtgctctccagcagacggcgtggtacccacagctaatgcctgccccttcctag
AACGAAGAGTCACTGAAGAAGTGCGTGGAGGATTACCTGGCAAGGATCACCCAGGAGGGC
CAGAGGTACCAAGCCCTGAAGGCCCACGCGGAGGAGAAGCTGCAGCT
gtgagtgctgggcgaggccccaccctggagggagaatctgagcacctgggccccagctca
gcctctgccccgcccctacccctccagggcaaacgaggagatcgcccaggtccggagcaa
ggcccaggcggaagcgttggccctccaggccagcctgaggaaggagcagatgcgcatcca

 2.17 Intr +  24374  24494  121  2  1  128   98   184 0.999  24.40
gaagaagtgcgtggaggattacctggcaaggatcacccaggagggccagaggtaccaagc
cctgaaggcccacgcggaggagaagctgcagctgtgagtgctgggcgaggccccaccctg
gagggagaatctgagcacctgggccccagctcagcctctgccccgcccctacccctccag
GGCAAACGAGGAGATCGCCCAGGTCCGGAGCAAGGCCCAGGCGGAAGCGTTGGCCCTCCA
GGCCAGCCTGAGGAAGGAGCAGATGCGCATCCAGTCGCTGGAGAAGACAGTGGAGCAGAA
G
gtgggtgcgggaagcccagctcaaggggccgtctggcagcaccttctagaaggcccttgg
gcctgctgctccctccaagcagggagaagccccgcaactcatcttcctcctccagactaa
agagaacgaggagctgaccaggatctgcgacgacctcatctccaagatggagaagatctg

 2.18 Term +  24610  24675   66  0  0   68   43   163 0.765   8.03
tccaggccagcctgaggaaggagcagatgcgcatccagtcgctggagaagacagtggagc
agaaggtgggtgcgggaagcccagctcaaggggccgtctggcagcaccttctagaaggcc
cttgggcctgctgctccctccaagcagggagaagccccgcaactcatcttcctcctccag
ACTAAAGAGAACGAGGAGCTGACCAGGATCTGCGACGACCTCATCTCCAAGATGGAGAAG
ATCTGA
cctccacggagccgctgtccccgcccccctgctcccgtctgtctgtcctgtctgattctc
ttaggtgtcatgttcttttttctgtcttgtcttcaacttttttaaaaactagattgcttt
gaaaacatgactcaataaaagtttcctttcaatttaaacactgaagccgctctggtcttg

Predicted peptide sequence(s):


>TACC3_1|GENSCAN_predicted_peptide_1|69_aa
MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATL
LCHSLLPLX

>TACC3_1|GENSCAN_predicted_peptide_2|944_aa
MESRRSAARGALWEMQSPCGCGLSSRPALEAAPHLCIEHRMSLQVLNDKNVSNEKNTENC
DFLFSPPEVTGRSSVLRVSQKENVPPKNLAKAMKVVVTVVLPRQWDETKSSRCVQLPTCH
SEDSRVAAWEGSAAPRWQLGSRGVSSPNHPNSRLFCQGPCAMQSHIVSSECPRDSQQLIK
EVDAKTTHGILQKPVEADTDLLGDASPAFGSGSSSESGPGALADLDCSSSSQSPGSSENQ
MVSPGKVSGSPEQAVEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAE
TPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADG
TQTLTCAHTSAPESTAPTNHLVAGRAMTLSPQEEVAAGQMASSSRSGPVKLEFDVSDGAT
SKRAPPPRRLGERSGLKPPLRKAAVRQQKAPQEVEEDDGRSGAGEDPPMPASRGSYHLDW
DKMDDPNFIPFGGDTKSGCSEAQPPESPETRLGQPAAEQLHAGPATEEPGPCLSQQLHSA
SAEDTPVVQLAAETPTAESKERALNSASTSLPTSCPGSEPVPTHQQGQPALELKEESFRD
PAEGTGAEVDYLEQFGTSSFKESALRKQSLYLKFDPLLRDSPGRPVPVATETSSMHGANE
TPSGRPREAKLVEFDFLGALDIPVPGPPPGVPAPGGPPLSTGPIVDLLQYSQKDLDAVVK
ATQEENRELRSRCEELHGKNLELGKIMDRFEEVVYQAMEEVQKQKELSKAEIQKVLKEKD
QLTTDLNSMEKSFSDLFKRFEKQKEVIEGYRKSRPGRCLRGRQRVLPTAAMLERRCSTPP
VEELDLQNEESLKKCVEDYLARITQEGQRYQALKAHAEEKLQLANEEIAQVRSKAQAEAL
ALQASLRKEQMRIQSLEKTVEQKTKENEELTRICDDLISKMEKI