GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:51:57

Sequence LETM1_1 : 45614 bp : 54.24% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +    624    723  100  2  1  108   92   149 0.421  15.70
cggcgcgcgggaccccaggggctgcttaggccagagcgaaacgaggggtccccccgcgcc
aacgcaggacccatatctacccctcccgctcagacgggaggacgcggtgtgccgggatgg
ggggccgctatgctggctgcgccgccacccggcctagtgccctcgcctccaggggccggc
ATGGCCCTGTCCTTCGGGGCGGGACCCTGCGCTCCCGTCCCCCCAGTGGTGACGGGGACT
CCCGACGCCGAGCAGCGCCGTATCTGGGGAGCGCCGCCCG
gtacgcagggaagaggcactcagagctgcgcgcgccagagtgcagaccgccgagggcaga
gccacagagcaggggggccggcgagggaccgcggccgagggcgtcgagggcgcccctcca
tccccagcgtcccctgacttgcccttggagccccaagctcccaggagccgttttctactc

 1.02 Intr +    927   1126  200  1  2  -34   28   197 0.028   1.09
agctgcgcgcgccagagtgcagaccgccgagggcagagccacagagcaggggggccggcg
agggaccgcggccgagggcgtcgagggcgcccctccatccccagcgtcccctgacttgcc
cttggagccccaagctcccaggagccgttttctactcgtgggtgcaggacttagtcccag
AAAAGTTCCGGACACACGCGCTGCTGCCGCCGCCCGGAGACGAAAAGACACTCCCCGCGC
AAGCGCGGCCGACTCCCTCAGCTCCTGCGGCCGCCACGCTGCGAGCCCCGGCGTCCACGG
TACGACGGGAACCAGGATGCAGCGAGCCCCAGGAGCCAGCCGCCCCGGTGCACGCCGGGA
CCGGTAGTCCGCGCCTCAGG
gtagtccgccgctccggtgcacgccgggatcggtagtccgcaccccagcgtgcaggccgt
cccggtgcacgccggaaccggtagtccgcggtggcgcggtccgcccctcacctggccagc
ggcgggcgctgaggggcccaatgggagccgcggcctggccgccccgccccgcgcctccgg

 1.03 Intr +   3815   3899   85  1  1   99   49    55 0.128   2.59
gatgagtgatacaccgagtggagtgctgcaggcccctgctattaacatcttagatgagta
gggttcgttgtcacagttaatgaactgaccttgatctgttactgttcactaaagtccata
acatattcagattttctttactctcccgttctccattctgaggtcctttttctgtcccag
GACCCATCTGTACCACCCTTCTTGATTGCCTCTCAGGCTTTCCTTGTCTGCAGTGACCTT
GACAGCTTTGAGGAGTACTGCCCAG
gtggagtgtagggtgctgctctactggtatttcttgatgtttcctcataattaagctggg
aaagatggtttttcaggaggaagaccacagaggtgaagcatccttatcatatcccgccga
ggctccatgctgtccaaatgatttgtcactgttgatgttgaccttgatcagtaggctgaa

 1.04 Intr +   8239   8299   61  2  1  136   76     6 0.115   2.48
aggaggctgaggcaggagaatcaattaaacccaggaggtggaggttgcagtgagccgaga
tcacgccattgcactctagcctgggcgcaagagcgaaactccaaaaaccaacaacaaaaa
aaggtatcagtataaatccctgatttactactcatttattttcccctgttcctgttacag
GTAGTCCAGGGGATCCTGCTCATCTCAGCTGTGCCAGCACCCTGGGGTTGAGGAACTGCC
T
gtgagtaaatcagtatcactctgcacctgtctgtttgaaaacagggtttgaaaatggtgg
agagtcacgagtgactcttgatttttgagggaaacagtgtatcctactttcctgttcttt
gtttcttttaaacctttatctttccattttgaaaatgattgtcacatgcctcagtgaatc

 1.05 Intr +  13793  13861   69  2  0   91   88    55 0.781   4.59
tcaagactgcatggattcaggggccccttcctggctcagaggtgaccccagagctgagga
gaacctagagacatggtggctggggctgggccagcgcctggagagagtctgaagctgccc
tcacagggattggggaggtgaccgaggtggggtgcctgtcccccttcccacccctcccag
GCCTCATTGGTGTCCACCAGGCACCTTCCACGTGTCTATTTCCCGTATTCTTGAGAACCT
CTCCGTGAG
gttagtgttgggtttgcatgtctgtaattgagggaagattttgagcctgggagagttttt
gggggaggtccccagaccattactggtgcagagtggagcccctgctgctctggcttctga
tcctggtgtgtgctcgctctaagctgccctgggctgacagtgccctgcaccagccgcact

 1.06 Intr +  15651  16101  451  0  1   93   95   484 0.568  43.48
tcccttccgaagggctccccagcgggcagtgcaaaacgtcaggaagtaggtgggattgtg
tgtggttgtgacatggcatggcacggggcatgtgggttttgctgctgttggtgttcggtg
ctgagctgtcaaaggctagtgctggctcttactactgttttccactcttcccttttcaag
GAATGTTCCATTTGGCTGCTGCACTCCCATCCACCCTGTGTACACATCCTCCAGAGGCGA
TCACCTCGGCTGTTGGGCTCTGAGGCCCGAGTGCCTTCGCATAGTGTCGAGAGCGCCATG
GACCTCTACCTCTGTGGGTTTTGTGGCTGTGGGACCTCAGTGCCTTCCTGTGCGTGGCTG
GCACTCTTCGCGCCCTGTTCGCGATGACTCGGTAGTAGAGAAGTCCCTCAAGTCCTTGAA
GGACAAGAACAAGAAGCTGGAGGAAGGCGGCCCGGTGTACAGCCCCCCCGCAGAGGTGGT
GGTGAAGAAGTCCCTGGGGCAGCGGGTGCTGGACGAGCTGAAGCACTACTACCATGGCTT
CCGCCTGCTATGGATCGACACCAAGATCGCGGCACGCATGCTCTGGCGCATCCTCAACGG
CCACAGCCTGACCCGCCGGGAGCGCAGGCAG
gtaatggggacatgtctagtcctttcttttctttcttgctctatcacccaggctggagtg
cagtggcgcaatttcctgggcatgggcgatcctcctgcctcagcctcccgagtatctggg
accacaggcatgtgccaccacacctggctaattgttttttatagatccagggtcccactt

 1.07 Intr +  20876  21019  144  1  0   85  116   146 0.946  18.09
gaaagaagtgggttttgggaatggtctgctaagtggttctggaacttagagtcctcagtg
ggtcctgtgagtcgctgcctgaggttgtgcctataaaccattataggagaaatgctcaca
ccccttgcccttgttcccacatgtgctctgctcccctctgatggattccgccccttccag
TTTCTCCGGATCTGCGCTGACCTCTTCCGCCTGGTGCCGTTCCTTGTGTTCGTGGTGGTG
CCGTTCATGGAGTTTCTGCTGCCTGTTGCTGTGAAGCTCTTCCCCAACATGTTGCCATCC
ACATTTGAGACTCAGTCACTCAAG
gtaagggcagcatcccaactgcttgttttagaatgagtctgaaattcattgtgatggctt
ccttgtttgtgacttttcaggtgctagatatttttgagactttatgtatcttcatattgt
ccttgtgctgtgcaataattatttagtggatgctgggttttggatttgtttctctttatt

 1.08 Intr +  22466  22603  138  1  0   90   48   253 0.999  22.67
cacacgggtactttttaaaaccatgaaataaaagagtttgagaatgtattgcacttagat
gagagtcagtgtgttgtgaaatgtttctgggagtgggggtcgggcacaggcgtgagatgt
tttccttgcccgaaccacagtctgagcagttggaatgcagtgccctctctgcccttgcag
GAGGAGAGGCTGAAGAAGGAGCTTCGGGTCAAGCTGGAGCTGGCCAAGTTCCTCCAGGAC
ACCATCGAGGAGATGGCCTTGAAGAACAAGGCAGCCAAGGGCAGCGCCACCAAAGACTTC
TCTGTGTTTTTCCAGAAG
gtgctgtgatacgtctgagtccctgtgacctcaccagggagccttccctgattttctgtt
tccctttcgctgtgctcagcagagtggagctcccccaggtgctggctggcgcttgaaagt
ttacccaggaggctcagtcgggggccagtggagtgtcaggagtctgcccccacgagctcc

 1.09 Intr +  24501  24704  204  2  0   88  105   402 0.998  41.82
tgcattccagcctgggtaacagagcgagaccctgtctcaaacaaaaaaaaaaaagaagaa
gtagtcagtggtttgagtccctgaggatgagaggcagcaccctttgggaatgtggttggt
cgtgggagggagccgggtgggcgcgtgtcccggggatgacccttgtgaccacttccgcag
ATCCGGGAAACAGGGGAGAGGCCCAGCAATGAGGAAATCATGCGTTTTTCCAAATTATTT
GAGGATGAGCTGACCCTGGACAACCTGACACGGCCGCAGCTGGTGGCCCTGTGCAAGCTG
CTGGAGCTACAGTCCATCGGCACCAACAACTTCCTGCGCTTCCAGCTTACCATGCGGCTG
CGCTCCATAAAGGCAGACGACAAG
gtgagcctggccatactccgcgccacagctctggtgttttaccttttcgtttcctgatga
taaaagcagcatgtcctcattgtagaaactctggaagatgctgaacgatcgaaaataagc
tcactaggagtcttgccacttgcagattgcagatcctttgaagatggatgtcttttctct

 1.10 Intr +  25626  25698   73  2  1   41   93    67 0.397   1.97
atactaggagctcttaagatttcagttctcaggtaaaactgttcctcttgtcatctgtct
ttttgaatgcactaactctagttcacattgattactctaataactgggtggtccgtaggc
ctttttcttttgctctcccttctgattttgtttgtagtgtttagtttttcctgaatgcag
GCATTGTCTGTGGAAGACAAAGAGGTTCAGGGCAGTGTTGAACTCTTCCAGGAAGAGCCT
GCCTGCATCTCTG
gtgagcaggttgagggccagtcatttccatgaatcaaggcaaggccatgtggggagcctg
tatcccgcccttgccgggacacaacaggcaccccagccctggtggtgatggtgtcagaga
aggctgagggggccagcccctgtggtgtcagtggagaccaggtggggggcttgagctttc

 1.11 Intr +  25893  26011  119  1  2   52   75    23 0.115  -1.91
ggccagtcatttccatgaatcaaggcaaggccatgtggggagcctgtatcccgcccttgc
cgggacacaacaggcaccccagccctggtggtgatggtgtcagagaaggctgagggggcc
agcccctgtggtgtcagtggagaccaggtggggggcttgagctttcctctcatctgacag
TGTATCCGCCACACTTCCCCACCACTGGGGTGGCCTTGGGGGCCCAGCGGAGAGTTGGGA
CTTTGACCACTGCCCAGCAGGAACAAGGTCACGTCTACCATGGTGCCAGTGGGAGCCAG
gtgggaaacagtactgagatgcttctgccctcctactgggggagacacctgtgagagcca
gaactcccacccacccgttcccagcggtagcaagcagcaccgctgtcccgcagatgtctg
tggaggctggatggggagcctgcacttcttacgaggcagcgctcccaccacttctaaaat

 1.12 Intr +  31765  31884  120  0  0  104   96   153 0.999  18.89
agatcctgaccctccgtcacaggcttccagtcacttctaacctagaactgggctttggtg
gccgtggtttgattcttgcttggcaaaatctgttagccacttattctggagggtgttcac
acagacactgtcacccaccagcaactgtcccagatgataattcactgctttgttttctag
CTGATTGCTGAGGAAGGGGTGGACAGCCTGAATGTCAAGGAGCTGCAGGCAGCGTGTCGG
GCACGAGGCATGCGGGCCCTGGGCGTCACGGAAGACCGCCTGAGGGGTCAGCTGAAGCAG

gtgcgtgaatattggcctggtgccaggccggcacgggctcaagggaaacatcagcctcga
aaggccactcggaggctcttcccaaactctgggccggcctggcgaggcgacactgtgacc
tctctggggacggccaggatgtttgggctgtttctcgcccttctgctcctaccgcactca

 1.13 Intr +  33673  33804  132  0  0   71   76   137 0.995  12.15
ctctggtgttttgtttactaacgccgtcatcgggtcacgcagcacagcaacaaacagacc
ttgtagaacttgagacactgtcttctctgagagctattctggtgatgagatgggcggacc
tgctgtggggccagcagggttggggggctgcccatctgctgaacctggccttggttgcag
TGGCTGGACCTGCACCTGCATCAGGAGATCCCCACATCGCTGCTCATCCTGTCCCGGGCC
ATGTACCTCCCGGACACCCTCTCTCCAGCCGACCAGCTCAAGTCCACACTGCAGACCCTC
CCAGAGATTGTG
gtacgtgctgtcggagaccccttttacctcatctcttcataggtggctccgctcttctgg
ggtggggggaggtgtgcaagcgcactcattcctcaaccatgggcgaggagcctgcctccc
accccctcgcgagtgcccccacccagccacctgtccccttccttccatccctcctcacca

 1.14 Intr +  34299  34460  162  2  0   63  103   339 0.879  33.59
agtcatcgggcgagcgcagagggcggcccaggggcctcccagcaattgcgggcagcacct
cggcagtgccttctgtcctgtgtgtgtgaagcccaggtggtgacggggcaggggacacag
gacacaggacagaggtgaggggcagcaggggcctctggtggcttctgggctcacccacag
ATGTACCCTCTTCTGAAGGCAAAGGAAGCACAGGTGAAAGTGGCCGAGGTGGAGGGCGAG
CAGGTGGACAACAAGGCCAAGCTGGAGGCCACGCTGCAGGAGGAGGCGGCCATCCAGCAG
GAGCACCGTGAGAAGGAGCTGCAGAAGCGCTCGGAGGTGGCG
gtaagcggtggtcctgctccgtgccgcgtggggctgtcctgagccagcctccctagaaac
ccccgcacgcccacagtcttggcctcccgcatgcttgccctgcagctctgtcctgcatgt
ttatttcctcctggagtggtcagggaggcagggtgcccgggtgtgagggctgcaactctg

 1.15 Intr +  35136  35267  132  2  0   84   90   111 0.992  12.25
caggtgacctggcagctgcatggagcctccctagggaccttctgtggcaggtgtgctgcc
caatgtcacctgcaggcctgctcccagtgtggcctctgccatatgttctgagcttcgggg
agcaagaagactgcttctgtgtgatggcgggcgctgggctggtgtcgccttgcctttcag
AAGGATTTTGAGCCCGAACGTGTGGTAGCTGCTCCCCAAAGGCCGGGGACCGAGCCACAG
CCAGAAATGCCTGACACAGTCCTGCAGTCAGAGACCTTGAAGGACACTGCCCCGGTGCTG
GAGGGCTTGAAG
gtaatgaggcaggttctggggccctggaggctgaggagggcatggcctggctttgtggac
agttgtggggcagggatggggacaggttagctggggcatctatagccctcagtgagagga
gatggtgcaaggggttgaggatgaggccactgggcccctaggaggcttggtggttaggaa

 1.16 Intr +  37976  38110  135  1  0   83   90   304 0.996  31.37
cgtgcagcagccagcgcagcagtgaacctgaaccccgcgggtctcttgttaccaatgact
gtccagtgagactcttgccctgggctgcccgtataatatgaacagagcagctggtcactt
gggaacaggccagttctttcccttggctcaggctttgttgtttgcccatttttatcccag
GAGGAAGAGATCACGAAGGAGGAAATCGACATCCTCAGCGATGCCTGCTCTAAGCTGCAG
GAGCAGAAGAAGTCACTCACCAAGGAGAAGGAGGAGCTGGAGCTGCTGAAGGAGGATGTG
CAGGACTACAGCGAG
gtgggtgggatttgctccctggactctgagactgcaagaagagtaaaatcgctgtactgg
ccccaaaagtatacataatacttccgtcagatacttgataagctggccaaagagtatttg
gagaggaaagcacgttataaataaaccttattcagtaacctttccacagccattccggct

 1.17 Intr +  40534  40721  188  0  2   14   84   291 0.987  20.31
tttgtatttttagtagaggcggggtttcaccacattggccaggctggtctcgaactccta
acctcaggtgatccgcccgccttggccttgcaaagtactgggattacaggcgtgagccac
tacacctgaccccctttttcttttaagacaaactttttacaaccaaaataattttattag
GACTTGCAGGAGATCAAGAAGGAACTTTCAAAGACTGGTGAAGAAAAGTACGTGGAAGAA
TCTAAAGCCAGCAAGAGATTGACAAAAAGGGTGCAGCAAATGATCGGGCAGATCGATGGC
TTGATCTCGCAGCTGGAGATGGACCAGCAGGCTGGCAAGCTGGCCCCGGCCAACGGCATG
CCCACGGG
gtgagtggggtggtgggcgcgggagagggatcggagactcacatagggaggctggtccct
ttgctggatccgagctgggcccttctggctccaaagggcacattgtagcctctgcctggc
tgcctctccacctttgaccagcagtcccagccaggaaccctctggcatgtcagtctctgc

 1.18 Intr +  41286  41481  196  0  1   31    8   188 0.649   5.04
gattcctgcgcagcagtggctgagggagctgccgttttgtgagtcccttctgggcgaatg
aaacagctgttgggtgactgctggtgccctgcaggttccaaatctccacctccacaccca
cagtgttgtaggtgggctgcacgtggcaccctgctcatgctctcgtccctgctcttggag
GCCCTCATCTGCCCAGGGCACCACAGCCCCCATGATCGTGAACGTATTGCCAAGTGGCCA
CAGGCCTGAGGACAACAGCCCAGCAGCCATGGCCCCAGAGGGGCAGCCACTGAGGGGCAG
ACATGCCCGTGGAAACCCTGGACCTGGTGGTGTTTCTGTGTTTGTGTCCACGCTGGCCCT
GGGAGCTCTTGGCATT
gtatgcaggatgggatcataccttgggggtccgtgctggaggttgcctggctcacgcgga
gccgcctgtgtcagtgctgaccacttgcagccacaggtgtgggcagtgaggccctgtgtg
gcaggacgcctgcccgtggccacatgcaggctgtgcttccacagggagaacgtcatcagt

 1.19 Intr +  41578  41784  207  0  0   40   86   315 0.561  26.30
aggggcagacatgcccgtggaaaccctggacctggtggtgtttctgtgtttgtgtccacg
ctggccctgggagctcttggcattgtatgcaggatgggatcataccttgggggtccgtgc
tggaggttgcctggctcacgcggagccgcctgtgtcagtgctgaccacttgcagccacag
GTGTGGGCAGTGAGGCCCTGTGTGGCAGGACGCCTGCCCGTGGCCACATGCAGGCTGTGC
TTCCACAGGGAGAACGTCATCAGTGTCGCTGAGCTCATCAACGCCATGAAGCAAGTCAAG
CACATTCCCGAAAGCAAGCTCACCAGCCTGGCCGCAGCACTGGATGAAAACAAGGATGGC
AAGGTCAACATCGACGACCTCGTCAAG
gtgggcctcgctggggaccacgcaggccatccgccacctgctctggagtggggtggggca
gggggactgttcattgcatgtccggcaccctcctgggcagctaccccctcctgtcagggg
tttgggtctgtcactgcgactgctcctttaagccgctgctctcatttgaaacatcagaag

 1.20 Intr +  42875  43012  138  1  0   88   57   276 0.447  25.67
ccagggtctgtggcaccccttgggggaattggtgctctgaggaccctggggcccgcaggc
agtgattgcgtgcatgctgctgccaccccagctggggcgactgacggcgctggccccgcc
tctgcctcactgtgctgtagggcgcagccacctgagcctctccctttcccacgtgtgtag
GTGATTGAGCTGGTGGACAAAGAAGATGTTCACATCTCCACCAGCCAGGTGGCTGAGATT
GTAGCAACACTGGAAAAAGAGGAGAAGGTGGAGGAGAAGGAGAAGGCCAAAGAGAAGGCA
GAGAAGGAGGTCGCAGAG
gtgaagagctagaaccactggcctgggcacctgtcctcctgctgtgccgtcaccctggca
agggccgtgagggcgattgctttgtggtgattctcagtggctcatctaatattttggctg
gaataaatcagagacttccataatcaagtaaattttaattttcatcattccacggagatt

Predicted peptide sequence(s):


>LETM1_1|GENSCAN_predicted_peptide_1|1018_aa
MALSFGAGPCAPVPPVVTGTPDAEQRRIWGAPPEKFRTHALLPPPGDEKTLPAQARPTPS
APAAATLRAPASTVRREPGCSEPQEPAAPVHAGTGSPRLRDPSVPPFLIASQAFLVCSDL
DSFEEYCPGSPGDPAHLSCASTLGLRNCLPHWCPPGTFHVSISRILENLSVRNVPFGCCT
PIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRD
DSVVEKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTK
IAARMLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNML
PSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRET
GERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIK
ADDKALSVEDKEVQGSVELFQEEPACISVYPPHFPTTGVALGAQRRVGTLTTAQQEQGHV
YHGASGSQLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPT
SLLILSRAMYLPDTLSPADQLKSTLQTLPEIVMYPLLKAKEAQVKVAEVEGEQVDNKAKL
EATLQEEAAIQQEHREKELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLK
DTAPVLEGLKEEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEI
KKELSKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGPS
SAQGTTAPMIVNVLPSGHRPEDNSPAAMAPEGQPLRGRHARGNPGPGGVSVFVSTLALGA
LGIVWAVRPCVAGRLPVATCRLCFHRENVISVAELINAMKQVKHIPESKLTSLAAALDEN
KDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKVEEKEKAKEKAEKEVAE