GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:04:41

Sequence IL21_1 : 10829 bp : 37.41% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1268   1414  147  1  0  114   91   104 0.992  13.30
gttactcacattcatccattttacaaagatttccaggctgcaatgggagggctttacctc
tccctgaaggatgaataaataggtagcttaactgacaacctgttctcagtcaagctgaag
tgaaaacgagaccaaggtctagctctactgttggtacttatgagatccagtcctggcaac
ATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTTGGGGACACTGGTCCACAAATCA
AGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGCGTCAACTTATAGATATTGTTGAT
CAGCTGAAAAATTATGTGAATGACTTG
gtaagactatatttgtcacaacaaaatctaaatcatacttttcaattaatataaaaggag
ggtttggcttataaaaataactcagaacaaattttcttttgctctaggtccctgaatttc
tgccagctccagaagatgtagaggtaagaccagttgaatttatttctgaaaatacattgg

 1.02 Intr +   1522   1557   36  0  0   88   94    45 0.860   2.64
agatcgccacatgattagaatgcgtcaacttatagatattgttgatcagctgaaaaatta
tgtgaatgacttggtaagactatatttgtcacaacaaaatctaaatcatacttttcaatt
aatataaaaggagggtttggcttataaaaataactcagaacaaattttcttttgctctag
GTCCCTGAATTTCTGCCAGCTCCAGAAGATGTAGAG
gtaagaccagttgaatttatttctgaaaatacattggacataagtttttaaatccaataa
gaaagacattagcatgattatataggagtatactgaattttaatgaacttagcggtctaa
taattgatgaaatatttatttatattttggttaaattcattgatttaccaaaaaccaact

 1.03 Intr +   6421   6576  156  0  0   85   57    99 0.604   5.79
gggattgtccctttttcccatcccaaagattaagtaggaggtgaaatcatacctcactca
tctgttgaaacgatgtaatgcacgacattgcagaagagatagaaatagaggattgggaaa
gctatcttttactttctgaataatgtttgttaacatatatacaaattgtttatctttcag
ACAAACTGTGAGTGGTCAGCTTTTTCCTGCTTTCAGAAGGCCCAACTAAAGTCAGCAAAT
ACAGGAAACAATGAAAGGATAATCAATGTATCAATTAAAAAGCTGAAGAGGAAACCACCT
TCCACAAATGCAGGGAGAAGACAGAAACACAGACTA
gtaagattgtcatttgtcatctctcttatttgtacttataaactatatatcttgcattac
ataaacatacacacacacctgtagccagggctgctggtgtcttccttacctatagttatg
ccttattatacatggtgcttttttttttttttttaagacagagtctcactctgtcaccca

Predicted peptide sequence(s):


>IL21_1|GENSCAN_predicted_peptide_1|113_aa
MERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDV
ETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL