GENSCAN 1.0	Date run: 16-Jan-104	Time: 09:05:08

Sequence GPR78_1 : 8781 bp : 58.15% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   1868  668  0  2   98   72  1261 0.999 118.59
tgccccggaccctgcacttgccgccgctttcctcgcgctgctctggaccttgctagccgg
ctctgcacctcccagaagccgtgggcgcgccgctcagctgctccatcgcctcactttccc
aggctcgcgcccgaagcagagccatgagaaccccagggtgcctggcgagccgctagcgcc
ATGGGCCCCGGCGAGGCGCTGCTGGCGGGTCTCCTGGTGATGGTACTGGCCGTGGCGCTG
CTATCCAACGCACTGGTGCTGCTTTGTTGCGCCTACAGCGCTGAGCTCCGCACTCGAGCC
TCAGGCGTCCTCCTGGTGAATCTGTCTCTGGGCCACCTGCTGCTGGCGGCGCTGGACATG
CCCTTCACGCTGCTCGGTGTGATGCGCGGGCGGACACCGTCGGCGCCCGGCGCATGCCAA
GTCATTGGCTTCCTGGACACCTTCCTGGCGTCCAACGCGGCGCTGAGCGTGGCGGCGCTG
AGCGCAGACCAGTGGCTGGCAGTGGGCTTCCCACTGCGCTACGCCGGACGCCTGCGACCG
CGCTATGCCGGCCTGCTGCTGGGCTGTGCCTGGGGACAGTCGCTGGCCTTCTCAGGCGCT
GCACTTGGCTGCTCGTGGCTTGGCTACAGCAGCGCCTTCGCGTCCTGTTCGCTGCGCCTG
CCGCCCGAGCCTGAGCGTCCGCGCTTCGCAGCCTTCACCGCCACGCTCCATGCCGTGGGC
TTCGTGCTGCCGCTGGCGGTGCTCTGCCTCACCTCGCTCCAGGTGCACCGGGTGGCACGC
AGACACTGCCAGCGCATGGACACCGTCACCATGAAGGCGCTCGCGCTGCTCGCCGACCTG
CACCCCAG
gtattggcccagtgcatgccgacaggcccaggccagggacttgggcgctccctgggcagt
tggcttgaggagcctgtgggcatcaccaccgttactccgcccagagttcaccagccacag
cactgcccctgcacgctgctcacaggggtttcctgttggttcattggtgcagacactgcg

 1.02 Intr +   2749   2862  114  1  0  130   94   156 0.977  21.13
caaaaaagcaagcctaccccttgttctttctctctcccccatccctctgtcctcctcagg
ttccaggctaaacatcctcctgaaaccctcctgtctgccctcacttcagcccctgggctc
tgggcctgggttctgtccccaccctgccatcatcctgaccactgtcctctgtccccacag
TGTGCGGCAGCGCTGCCTCATCCAGCAGAAGCGGCGCCGCCACCGCGCCACCAGGAAGAT
TGGCATTGCTATTGCGACCTTCCTCATCTGCTTTGCCCCGTATGTCATGACCAG
gtgggtcctggcagtccggctcctgttgtgggaacagctgggtgggcttggcctcagttg
agtaggcctctgaggtttcccagcaagatatctggagggcggccaccaccagaggaccct
cctccacacctgacgggctcagggctgtgcttcagctcctgggaaagatcctgggaggga

 1.03 Term +   7273   7582  310  1  1   93   55   482 0.998  40.96
tgtaatcccattttaggaagaggagcccaaggctcagggtgctggtgcagagccccctgg
ctagtgagcatcagggctgcggtacgtacttgagtatggttctagcaccttcccccggag
cgtgagtgcgtggcaggtgctgtcactgtggctgagttagctgctccgcttccccaacag
GCTGGCGGAGCTCGTGCCCTTCGTCACCGTGAACGCCCAGTGGGGCATCCTCAGCAAGTG
CCTGACCTACAGCAAGGCGGTGGCCGACCCGTTCACGTACTCTCTGCTCCGCCGGCCGTT
CCGCCAAGTCCTGGCCGGCATGGTGCACCGGCTGCTGAAGAGAACCCCGCGCCCAGCATC
CACCCATGACAGCTCTCTGGATGTGGCCGGCATGGTGCACCAGCTGCTGAAGAGAACCCC
GCACCCAGCGTCCACCCACAACGGCTCTGTGGACACAGAGAATGATTCCTGCCTGCAGCA
GACACACTGA
gggcctggcagggctcatcgcccccaccttctaagaagccctgtggaaagggcactggcc
ctgctacagagatgccactggggacccccagacaccagtggcttgactttgagctgaggc
tgaagtacaggaggaggaggaggagagggctggatgtgggtgtggacagcaggagtggcg

Predicted peptide sequence(s):


>GPR78_1|GENSCAN_predicted_peptide_1|363_aa
MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDM
PFTLLGVMRGRTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRP
RYAGLLLGCAWGQSLAFSGAALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVG
FVLPLAVLCLTSLQVHRVARRHCQRMDTVTMKALALLADLHPSVRQRCLIQQKRRRHRAT
RKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRP
FRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPHPASTHNGSVDTENDSCLQ
QTH