GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:23:37

Sequence ETFDH_1 : 38722 bp : 38.71% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +    434    758  325  2  1   51   42   335 0.287  18.45
ctcctcaccactaaatctaaagggggaaccctcagagaggggtggcactttagctgctgg
catcccccccgcttcccgcccgcacgctctggggcgcagaagggccggtcgtcccgggtc
atgggggttgggggaccgattccctagcctcgcgagccccgccgccgccggtcttcccag
AGGCGCCGAGGGGGGACGCGGTCCCGACACCACACTCACGTCTCCGATCTGCAGCTCCAC
TTCCTCCAGCTGGTCCACCGTTGGGCCGCTGCTCCTGCTCGGAACTGGCCAGCCCAAACT
CACTGGGCCGCCCGGGGAAGATGCTGCAGAGGCGTCTGAAGAGGAGGGAGAAGAGGGAGG
CGGCGGGGGCGGCGAAGAAACCTGCAACTCCTCAGGGTCGGCCATGGGGAAGGGTTGGGA
CCGCGGAATCCGACCCGAGAAGCCGAACCGACACCAACTGTCTTTTAACCACTCGCGCCC
AAAGCCGAAAGGCCCCGCCTCCTAA
cgccagaaatcccgcccagtctcctcgtgggtctcagccccggaccacaaagacgtttca
tttttcgggacagccaatcatatgagtcaattcaccttaggcaactcacggctcctgcgc
gagcctccaatcgatctcgaagggcactcgtagagaaaactacacctcccaggaagccgt

 2.01 Init +  11060  11281  222  1  0   85   43   303 0.876  24.10
taagaatataatcatactaatacagtaatatgcttaatataattattgtgcaaaacacag
ggagaatttccataaataatactctaaagcacagtggatattttttaactgtcatgtgat
ttatcatgtgattattgggttatattaatcccagaatttttatttctcccaggagtgaac
ATGGAAAGGTTTGCAGAAGAAGCAGATGTTGTAATAGTTGGTGCAGGCCCTGCAGGGCTC
TCTGCAGCTGTTCGTCTAAAACAGTTGGCTGTGGCACATGAAAAGGACATCCGTGTGTGT
CTAGTGGAGAAAGCTGCCCAGATAGGAGCTCATACTCTCTCAGGGGCTTGCCTTGATCCA
GGTGCTTTTAAAGAACTCTTCCCAGACTGGAAAGAGAAGGGG
gtatgaaaaattgttttttatacaaagtctaatcttttgtaattgtatttcagtaattgt
tcccaaattactggaatataggaaacccttttcatgtaactctatcttttttttttttct
ttttttgagatggagtttcactcttgttgcccaggctggagtgcaatggcgcgatcttgg

 2.02 Intr +  13449  13535   87  2  0  107   75    41 0.541   3.95
tctgtacatctcagacagagaaaggattcacagtgacaagttttataaaggaaatgccaa
aagaaaattaggggggagttctttttttgtcatcagagtacattttatagtttttttgta
tttatatttacacttgcaaatataaactaaaaacatttctttttcttcttttatttctag
GCTCCACTTAACACTCCTGTAACAGAAGACAGATTTGGAATTTTAACAGAGAAATACAGA
ATTCCTGTGCCAATTCTTCCAGGTAAG
gtatagtgaatatgcatagaactatggaattccacagctggaaggaactacatttcatct
gacgaaatttcctccttttacagacaagaactgagacccagatatttgaaggacttactc
aaagctatacagctagctggtgggaaagcaggactagaactcagttcttttgtcttccag

 2.03 Intr +  19205  19282   78  1  0  100   92    79 0.951   8.33
aatactctggaagggagtaccttaatacatgtctctttattacctgaacattttaaactc
tgtatttctataatctagagaagatgttcaccttctaagaaacctaaggctgtttactgt
ttttttcaagattattatgaattctaaggtattaataaatttgttttttatcatttttag
GTCCTTTTTCATGATGATGGTAGTGTAAAAGGAATTGCCACTAACGATGTAGGGATACAA
AAGGATGGTGCACCAAAG
gtaaacctttttaatagttacgtgcttaataaagcgacaaacaacagaaagaactgtgtg
ggcatcaaagtgaaaccccatctctccaaaaaaagaaaacaaaattagctgggcttcgtg
gtatacacctgtagtcctagctactttggaggctgaaacaggaggatcacttgagcccag

 2.04 Intr +  22162  22266  105  0  0   86  119   -19 0.580   0.49
aagctttctccctgcgatttcactgaaacagctcttgttagagtcacaaatacctccatt
ttgccaatctggtggacaggtctctgttttcccttacttgaccttctagtgggtagcact
tgacacagttggattatgttttccttcttgaaacacttttttgacttggctctcttacag
CCTTCTCTTGGTTCCTATCTCCAATATGCATCTTATCATAAGAATTCTGATTTGGACATT
TTTAAGTTACAGAGGTTAAGTAACTTGGCTGGGGTCAGACACCTG
gtaagtagtagggctgggatttgaatacaggctgtgtggctccacggcctgtcccttgaa
cactaaagggcatgttacctctaagaagaaacagaaatatgttcatgaatattttagttc
atacagattgaattgttttataagtggtgctggggaaactatatccatctggaagcaaat

 2.05 Intr +  24354  24500  147  2  0   95   53   106 0.994   7.31
gtgagaagagtaagattatatgattctatatattatatatttactatgtgattctttata
atattatacatttgcactgtctcttctacatctgaatcatagttcaatttaaatctgacc
agaatgtgaatgtattttaaattgtcaaatgttgccatttaacatgtttttgcttttcag
GCAACATTTGAGAGAGGACTGGAACTACATGCTAAAGTCACAATTTTTGCAGAAGGTTGC
CATGGACATCTAGCCAAGCAACTATATAAGAAGTTTGATTTGAGAGCAAATTGTGAACCT
CAAACCTACGGGATTGGACTGAAGGAG
gtatcctggtttgtttctgtaattttaattttgaaagatggaatttaaatttatttgtat
tatcaggtagtttataatactgatttaattttagttatattttttcattgtcttgaaatg
ttcattatgactaaaacttatttgcgatatttttcaaggggctagaagatattactgatc

 2.06 Intr +  26416  26556  141  0  0  107  103    79 0.994  10.93
gccaccgtgcccagccttctttgatatttgaagtaattttgttgtattcttatatcacag
tttttcacttgtaattttcataaataagacattaaacctggcaagttttatgcattgtgg
tgacataaaaacatttttaaaatactgcaggacttttttgtttgctttttttttttttag
TTATGGGTTATTGATGAAAAGAACTGGAAACCTGGGAGAGTAGATCACACTGTTGGTTGG
CCCTTGGACAGACATACCTATGGAGGATCTTTCCTCTATCATTTGAATGAAGGTGAACCC
CTAGTAGCTCTTGGTCTTGTG
gtaagttatattcccattagggaaaattctgctgctagagttatattaccatcagtgtta
taaaataagggttttgaatctgaagactgtaaaatgctttttatttaaagctttctaatt
ttatcaatatgtaaagtgcttatggctgctgtgtcattaagtctactaaacacacgtagc

 2.07 Intr +  27844  27987  144  0  0   17   93    83 0.693   1.26
ttttccaaacagattttatacaatttttaatttacatttggattactgcacatagtgctc
caaatacttttgagtaaaagaaatttaacctacatgttttctgataaacattgcttacat
tttagcttgatttaatttgaaataaaaatgtctaattaaatataagtgtaaatttttaag
GTTGGTCTAGACTATCAGAATCCATACCTGAGTCCATTTAGAGAGTTCCAAAGGTGGAAA
CACCATCCTAGCATTCGGCCAACCTTGGAAGGTGGAAAAAGGATTGCATACGGAGCCAGA
GCTCTCAATGAAGGTGGCTTTCAG
gtaactcttccaacttttattttccttgtttctgtattataaattcagaattgaacatat
aatgtaacaaatttagataaagaataaaaacaatattggaataggaaaagtatgtagagt
ttataaaactgtgtcacacaatacttcaattacaccatgaatttagttttaagaatatat

 2.08 Intr +  32280  32448  169  2  1   68   82    57 0.818   1.70
tagggcaggaagaagaaaactgcccttgctctgttttattcctttgctcaattcattttc
atgtatttatttttcagcctttccctacagctctagaatactttaagactgatttggagt
attctgttgttcttgtttaatatgaactaacaaatgtattctgaatctttgtttcctcag
TCTATACCAAAACTCACCTTTCCTGGTGGTTTACTAATTGGTTGTAGTCCTGGTTTTATG
AATGTTCCCAAGATCAAAGGTACTCACACAGCAATGAAAAGTGGAATTTTAGCAGCAGAA
TCTATTTTTAATCAACTAACTAGTGAAAATCTCCAATCAAAGACAATAG
gtaagaaattcctgtgtaaagtatacaaaagaaaattgctgggttatgtgtatttcaatt
gacattaaaagatttgtattgcatctgtcactttatagaaagtattaataagcatgctat
gcaaagaaaactacatggcttattctcaataattacagtcagtgattttttactgtaatg

 2.09 Intr +  35486  35707  222  0  0   16   90   133 0.900   3.48
ttttaatgttttcaacttggagaaattataaatttagtgtctaagaacagtatattatta
cttgagggctagtcatatttctttggtgtgataatattttgaagtttttatacaaatagg
cttaagaaaaagtacttcaaaatcatattttgttaagcatttccctcaaaattgttgaag
GTTCTGACTTTGAACGGCTCAAGCCAGCCAAGGATTGCACACCTATTGAGTATCCAAAAC
CCGATGGACAGATCAGTTTTGACCTCTTGTCATCTGTGGCTCTGAGTGGTACTAATCATG
AACATGACCAGCCGGCACACTTAACCTTAAGGGATGACAGTATACCTGTAAATAGAAATC
TGTCGATATATGATGGGCCCGAGCAGCGATTCTGTCCTGCAG
gtaataatttccatctattcctaaatatttgctttaaacattttaggaatgtgattttgt
tcttttaaaaaatgatttctgtatctccttccattccttagaaattgtaaatgacttcat
ccagcttcctttaggaaacatacttttaactactggttttgttaagcctagttcagataa

 2.10 Term +  37221  37384  164  1  2   75   37   219 0.998  12.62
gtacatgtaatttacactcacatcaatagcaatgcaccaaggtcttcataatctctatgg
gtaagcattcagaaagcaacctttaaggtttctgtggctactctttccttaatttttact
tttgaatttaaaaattttttaaagttaggcacttcaatattatttatttttacttttcag
GAGTTTATGAATTTGTACCTGTGGAACAAGGTGATGGATTTCGGTTACAGATAAATGCTC
AGAACTGTGTACATTGTAAAACATGTGATATTAAAGATCCAAGTCAGAATATTAACTGGG
TGGTACCTGAAGGTGGAGGAGGACCTGCTTACAATGGAATGTAA
actgcagctagccagtttctttcaagtatggcaagctaacgttaaaatgtttagagatta
acagatttcagaatgtctttctgcatattactgaacagaatagtcacaaaatgattatca
aataaaaattttatactatatgtaagattgtcccataaagaaattacgggtattgctttt

Predicted peptide sequence(s):


>ETFDH_1|GENSCAN_predicted_peptide_1|108_aa
XGAEGGRGPDTTLTSPICSSTSSSWSTVGPLLLLGTGQPKLTGPPGEDAAEASEEEGEEG
GGGGGEETCNSSGSAMGKGWDRGIRPEKPNRHQLSFNHSRPKPKGPAS

>ETFDH_1|GENSCAN_predicted_peptide_2|492_aa
MERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLDP
GAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGKVLFHDDGSVKGIATNDV
GIQKDGAPKPSLGSYLQYASYHKNSDLDIFKLQRLSNLAGVRHLATFERGLELHAKVTIF
AEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLDRHTY
GGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIAYGAR
ALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTSENLQ
SKTIGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIP
VNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVV
PEGGGGPAYNGM