GENSCAN 1.0	Date run: 16-Jan-104	Time: 09:12:23

Sequence DHX15_1 : 59476 bp : 37.36% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1083   1432  350  2  2   54   94   353 0.996  27.20
gccggggtaatagaaatgaataggatttcctaactaggactagactttctcaatttcttg
actcagaggggcaaggatagcctgaaatggaaagtgaaggccttcaggttcttcctaaca
gccgctccgaggaggggaaagctacaggaagagggaggagacccaagaaaggtcggacca
ATGAGGCAGCGGGCGGGACAGGAGTTCCCGCCTTTGGGCGTCGTGCGCGCGCACCTCGCT
CACACGCACACTCGCACGCACGCACGCTGCGGAAGCGCGCGCGCGCGCAGGCCCAGCCCT
CGTCGCCGCCGCCATTTTAGCTGTTGGTTCCGGCCGCACCGTGTGGGCTGTAGTAGCGGG
AGGGGTGGGGGTCCTCCAGAGTTAAGTGGCTGTCCTCGACTGTGCCCATACAGCAGCCAG
CTTTCTTCCTTAATAACTGCCCGTTCGAAGAGTGCGAGGATGTCCAAGCGGCACCGGTTG
GACCTAGGGGAGGATTACCCCTCTGGCAAGAAGCGTGCGGGGACCGATGG
gtaagccaggccgggggcgcgaggcggcagctcgggctttgttggggtcctggcagggag
cgggccggggctggcctggccgagcgggtcctggagcccgagcctttgtttctctctggg
ctgggttcactagcggcgggtaggagaagcgcggcgcccgttcggcccggcaagggcgcg

 1.02 Intr +   9077   9512  436  2  1   91  109   430 0.992  38.06
tgtggtggagaatgggaaacccttgattgtagggtattttttattatttctgatagttac
ataatccattggactttttattcatttgaacgttggacatttactctctttgtgattata
acgctaccgtgaacattctgcataaaattcagaatctgaattctaaatttttgtttttag
GAAGGATCGAGATCGAGACCGGGATCGTGAAGATCGGTCTAAAGATCGAGACCGAGAACG
TGATAGAGGAGATAGAGAGCGAGAGAGGGAGAAAGAAAAGGAGAAGGAGTTGCGAGCTTC
AACAAATGCTATGCTTATCAGTGCTGGATTACCACCTTTGAAAGCTTCCCATTCAGCTCA
CTCAACCCACTCAGCACATTCAACGCATTCAACACATTCTGCTCATTCAACGCATGCCGG
ACATGCAGGTCACACGTCACTTCCACAGTGCATTAATCCGTTCACCAACTTACCCCATAC
TCCTCGATACTATGATATTCTAAAGAAACGTCTTCAGCTCCCTGTTTGGGAATACAAGGA
TAGGTTTACAGATATTCTGGTTAGACATCAGTCCTTTGTACTGGTTGGTGAGACTGGGTC
TGGTAAAACAACACAG
gtgagttattgtataccatggtacatatttcatttatgtttaagtttaccaaatgttgca
tatttgattctggtggtcatttcccttgtctgtcctatagaacatcttgaagaatagctg
atttgatgtttaattggcactctgaatttcagagtggaaatcctatagagaatacctctc

 1.03 Intr +  14908  15101  194  0  2   20   97   187 0.559  10.17
cataactgttccttggtttagagagcttgtgttgttacaagttttgaatcacaagtctta
tagtcatttgcctaattggatttggttttaaatcattagaatgagataaagtgctttatg
ttacatatacttgatatgcaggcagaatagaattaatttaaatgtgaaattatttgatag
ATTCCACAGTGGTGTGTGGAGTACATGCGATCATTACCAGGACCCAAGAGAGGAGTTGCC
TGTACCCAACCCAGGAGAGTGGCTGCAATGAGTGTGGCTCAGAGAGTTGCTGATGAGATG
GATGTGATGTTGGGCCAGGAAGTTGGTTACTCCATTCGATTTGAAGACTGCAGTAGTGCA
AAAACCATTCTTAA
gtaagtactatatctttaatgacgcttttagtcctctgcttgccattttctgctattaga
tagaagactttgctagtgcaggcttatgtcatccaaatttagaattatccaaagtaggcc
ttcttagacttaccacatgaccttagtttaattatatattattggtaatctatagttact

 1.04 Intr +  29345  29504  160  2  1   54   67   176 0.713  11.17
actcttaaaagattttcttgaaacttaattttgcaattgatcatgaaacagtagcacatt
tgtttggggcagaagtttatttttaatttaccttatgtctttgcatttcatttttgtcac
gaagtttggttttaaaatgacctaacggaacctttaaccaacatgttctttggaatatag
GTATATGACTGATGGGATGTTACTTCGTGAAGCTATGAATGATCCCCTCCTGGAGCGTTA
TGGTGTAATAATTCTTGATGAGGCTCATGAGAGGACACTGGCTACAGATATTCTAATGGG
TGTTCTGAAGGAAGTTGTAAGACAGAGATCAGATTTAAAG
gtgaagtaatttcttctctccatttaactatatatgtgtgtatgtgggcataaaaatggg
gaatacatactgatcaataaccaactgtaagaaatcacctgtaaaagaaggaactagtaa
gtaccttcttgttttgtttctgctttgctgtgctttcattttagactttatttctccccc

 1.05 Intr +  30812  31030  219  1  0  101   57   173 0.999  13.08
tgtaaataacttttactatagttcagccattatgtatttgatttttcatttacagtttat
ttgaaggttttcatgggcatttttatagctgatatatgtagaatagtaaatattgctata
ctgtaagaccatgtaagaatccttgaagacagcttcaaataatttactgttttctttcag
GTTATAGTTATGAGCGCTACTCTAGATGCAGGAAAATTCCAGATTTACTTTGATAACTGT
CCTCTCCTAACTATTCCTGGGCGTACACATCCTGTTGAGATCTTCTATACTCCAGAACCA
GAGAGAGATTATCTTGAAGCAGCAATTCGAACAGTTATCCAGATTCATATGTGTGAAGAG
GAAGAGGGAGATCTTCTTCTTTTCTTAACTGGTCAAGAG
gtattgttttaattttcttcattatttagcttttgacatactgtttctaatatgcagcaa
ccttaatcataagaacatgttaatcatattttttatttcaatgttcttcaacctgattgt
attaatatgtaaaatatataaccccttttatctgcatactgtaggaatacttctgtatac

 1.06 Intr +  36733  36900  168  0  0   81   87   202 0.999  18.62
ggattgttttggaaatcccattgaaatttgctaaattagttttggttactaaattgaaaa
cagggtatccatgaagtgaaagaagatggcatacataaaacagactgcatagaactagga
ttataataaatactttaaaatgtttcagtattcgtttttagactcacttttattttgtag
GAAATTGATGAAGCCTGTAAGAGAATAAAGCGTGAAGTTGATGATTTGGGCCCTGAAGTT
GGTGACATTAAAATCATTCCATTGTATTCTACACTTCCACCTCAGCAGCAGCAACGCATT
TTTGAGCCTCCACCTCCCAAAAAACAGAATGGAGCAATTGGAAGAAAG
gtaacattagaaatgctctttataaatatttcactaataatgatttatgagatataaact
gtattcagttataaaggactaagttatgggtgattgtgatctaggttttatacaacaaaa
taatatccatttgtagggttccgcatatctcttgaccctaaagtaagaatgagtactgct

 1.07 Intr +  42729  42815   87  2  0  114   83    86 0.999   9.95
tggttccttaaatattaatttacctttttaaagcattggccattgaagatcaaatgatat
ttctagtttatttgctggcttgaaattccttgtgtcagtgaaagttagtggctgatcttt
aacagtcctgttaattttatttgatatgtaatataatttatatactctatttcttaacag
GTAGTTGTGTCAACTAACATAGCAGAGACGTCTTTGACAATAGATGGTGTGGTGTTTGTG
ATTGATCCTGGATTTGCGAAACAGAAG
gtacatatttagtggatactttataaattagagttggtttaacagtacttacaaccaatt
catttaatggctaaaatttacctttcagaattattttcctatctttttttttatttgcaa
atttctgctgtatgaaccctttatgttttggctggctctcagaaattaagacagtattta

 1.08 Intr +  43733  43882  150  1  0   56   80   141 0.998   9.54
gaatgtctgaaagaactttaaggttcaggatggtgggttgtctattgtagcagcatgatt
tatggctatcgatatttctttatttattttggaattaactgtgggctttggatacttctg
ttgcatcacaattttgtgtttgactgaagaaagactcttgtgttatttcaattccaatag
GTCTACAATCCTCGAATCAGAGTTGAGTCCCTTTTGGTGACAGCTATTAGTAAAGCTTCA
GCTCAGCAAAGGGCTGGTCGAGCTGGACGTACCAGACCTGGAAAATGCTTCAGACTTTAC
ACAGAGAAAGCTTATAAAACAGAAATGCAG
gtatggggtattgtcgtttcctgccgatatgtttaaaatgttaggttgaattatcttacc
agaagaacattgccttatttacttaatcttgccttttaggattaaaagctccttagcttt
tccaggagtgaaatgtatggtgtaattaacttagatagtcgtacacccccttattccagg

 1.09 Intr +  44807  44915  109  1  1  100   80    72 0.998   6.54
aaagatagttggagaaaaatggtttctctctagtctagcctacaagtatttatctctact
gagacagtgtagaagtaatgccaaaacaaatagctcaggaggcagcagatttttgttttc
tggaacgaggagactgaggcatttttaacataaccaataaatgtttttgttctttgctag
GATAACACCTATCCTGAGATTTTGCGTTCTAATTTAGGATCAGTTGTGTTACAATTGAAG
AAACTTGGTATTGATGACTTGGTACATTTTGATTTTATGGATCCACCAG
gtatgacttatcaaaacacatttttatcagatcttttaaccaaaattgactcttagtgtt
tttctccatcctatttaatatatgtattaaatacattttgctttttccatccagtatgca
tcaagattaagtcttacatgatagcattaaaactaaaaaaggtgacagttatatgagcac

 1.10 Intr +  45456  45647  192  1  0   44   90   153 0.800   9.64
ttttgcaatgtttttatgattcattgtttgctagatctgtataattgaattggatgacag
tttgagtttgagtttggtccactgcaaaatgaaaaatgagattgcttataatagtttgta
ctttgtcacatttttgcttgcttaaggcaccgtgtctaatagattgtcttttaccactag
CTCCTGAAACTCTGATGAGAGCCCTGGAACTTTTGAATTACCTGGCTGCTTTAAATGATG
ATGGAGATCTGACTGAATTGGGATCCATGATGGCAGAGTTTCCTCTAGATCCACAGCTCG
CAAAAATGGTTATTGCAAGTTGTGACTACAACTGTTCTAATGAGGTCCTATCTATTACTG
CTATGTTGTCAG
gtaatagagggaaaggaacaaaaaaaagcccagctcttcaaagtttgggtggacttcact
tttgtttttgttttttaatttttagtatgatagtggattttatagatggttttaaggaat
taattttgttttctaaataccttgtaaatagcttcgtaatgacatagtgcttacaaaagt

 1.11 Intr +  52701  52891  191  1  2  105   91   171 0.992  17.48
tcacactacagatctttgagaaagttggtaacattgcagttcatttaaagaaaatgttgt
gggtaaatctcctttctggtttatttagcttattctttataacaatttttttaattagag
aacattcctgtgtgggtgattcatggtgccttcttttctccccgccttctacctttttag
ATCATGAATCGGTTCAGTGGTGTTATGACAACTTCATTAACTACAGGTCCCTGATGTCCG
CAGACAATGTACGCCAGCAGCTATCTCGAATTATGGACAGATTTAATTTGCCTCGTCGAA
GTACTGACTTTACAAGCAGGGACTATTATATTAATATAAGAAAAGCTTTGGTTACTGGGT
ATTTTATGCAG
gtatgtagataatatgggaatgaataactaagtattcatatgacactgatttctattaac
agtcctttgaatccactcaaaagcaaaagtgagtttgtgcatgctcataaaaatttatct
taaatgttggtacatccagtttctttgagtgaattaatatactaagaaattttaagtatt

 1.12 Intr +  55985  56154  170  1  2   85  115   155 0.997  15.72
gttggatttggcccacaggcagcagtttgcttatctctgcttttatcagacagtgataaa
taagtatagccatagaatgaaaagtaaaagggaggcctgcctcttcctaattatgtaggt
agctttacaactagcaagtcagaagcattgtattaataatatactgggttttggtttcag
GTGGCACATTTAGAACGAACAGGGCATTACTTAACTGTGAAAGATAACCAGGTGGTTCAG
TTGCATCCCTCTACTGTTCTTGACCACAAACCTGAATGGGTGCTTTATAATGAGTTTGTT
CTAACAACAAAGAATTACATCCGGACATGTACAGATATCAAGCCAGAATG
gtaagtacaccttttgttctaacagttttttgttagtactttgctcaaaatggaacctga
ctgttgctagagtcatggccttgcattcactcattgagaatttatatttcagtgtgtagg
tatgagggaattgactggatggtgtgattaatctttcacacccttcctttgttaagtgga

 1.13 Term +  57714  57831  118  0  1   61   38   123 0.978   1.63
acttaacacatttctaaaagtgctatttgtaaggattagttatttgtatttttctgagac
ttgaattcatagatttgccttggttcatcagtatattaatgaataatgcctatcctatta
acaactccagtacttcaattaaatgttaatttggaaatttttctgcccacttctaaacag
GTTGGTGAAAATTGCCCCTCAATATTATGACATGAGCAATTTCCCACAGTGTGAAGCAAA
GAGACAGTTGGACCGCATCATTGCCAAACTTCAATCCAAGGAATATTCACAGTACTGA
attcagtgcttagaactgaagttattgagaggacagctttaaaagatgaatgaactcaaa
agttcgagttgtgctcttcacgttggttcgataatggcctttatttgaaagctttttaat
ttttctttacagtaaatattccattctgatttcataaattaaacatttatgcctcccttt

Predicted peptide sequence(s):


>DHX15_1|GENSCAN_predicted_peptide_1|847_aa
MRQRAGQEFPPLGVVRAHLAHTHTRTHARCGSARARRPSPRRRRHFSCWFRPHRVGCSSG
RGGGPPELSGCPRLCPYSSQLSSLITARSKSARMSKRHRLDLGEDYPSGKKRAGTDGKDR
DRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTH
SAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFT
DILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVAD
EMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTL
ATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEP
ERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIP
LYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVY
NPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNL
GSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPL
DPQLAKMVIASCDYNCSNEVLSITAMLSDHESVQWCYDNFINYRSLMSADNVRQQLSRIM
DRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLD
HKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQ
SKEYSQY