GENSCAN 1.0	Date run: 16-Jan-104	Time: 09:33:16

Sequence CDS1_1 : 68682 bp : 38.76% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1633   1911  279  0  0   37   94   313 0.191  23.55
gcctgcccgggacctccgccggagccgcgctcgctgcaggcggcctcgagcgctctctcg
ttgatgccgttttggaggtgaccggcgcggcggccgctctatggtggggccgcgttagtg
gctgcggctccgcgggactccagggcgcggctgcgaggtggcggggcgccccgcctgcag
AACCCTGCTTGCAGCTCAGGTTTCGGGGTGCTTGAGGAGGCCGCCACGGCAGCGCGGGAG
CGGAAGATGTTGGAGCTGAGGCACCGGGGAAGCTGCCCCGGCCCCAGGGAAGCGGTGTCG
CCGCCACACCGCGAGGGAGAGGCGGCCGGCGGCGACCACGAAACCGAGAGCACCAGCGAC
AAAGTAAGTGGAGCCGAGAGAGGCGGACGCCGCGCCCTGGCTGGGTCCTGGTTGGAAGCG
GGACACTTGAGAGCAAGGGTGGGGCCCGTCCAGCGTCAG
gtgaggctgcacgctgccggtgcaccttcctccctgcctggcactgcttcctccttctcc
agagggggtcgggacccgggatcccagtggcggtgaggttcccaggatgaccgcggccgc
tgcccgggagaaatgggccactcaacccggcttacagtttagcttcatcctcttccggtc

 1.02 Term +   1976   2146  171  1  0   51   50   146 0.907   3.94
ccgagagcaccagcgacaaagtaagtggagccgagagaggcggacgccgcgccctggctg
ggtcctggttggaagcgggacacttgagagcaagggtggggcccgtccagcgtcaggtga
ggctgcacgctgccggtgcaccttcctccctgcctggcactgcttcctccttctccagag
GGGGTCGGGACCCGGGATCCCAGTGGCGGTGAGGTTCCCAGGATGACCGCGGCCGCTGCC
CGGGAGAAATGGGCCACTCAACCCGGCTTACAGTTTAGCTTCATCCTCTTCCGGTCCCTT
CTTCAGGATCTGGGGCCGACGCTGGAATCAGGAGGGAACCTGTCCTCCTAG
gggctgcagtgcagttagtagctgccacctcacctctcttttcagtagagggaacaaagt
tagtaaggactagagacgtgccaccgtcggctgtatcatttcatcggatcctgacgcggg
aggcttggcttctcgcgctgccccatatgcacttacattttctccatcctttttcagtat

 2.04 PlyA -   3515   3510    6                               1.05
 2.03 Term -   4868   4806   63  2  0   69   36   105 0.442   0.31
 2.02 Intr -   5732   5628  105  2  0  106   88   105 0.860  11.79
 2.01 Init -  14440  14414   27  1  0  115   97     1 0.344   3.61
 2.00 Prom -  14727  14688   40                              -7.65

 3.01 Init +  25708  25762   55  0  1  100  109    47 0.264   7.52
atttgttggaagtatttaaactatattggagagtggttgaaagcaaggaatgtaatcttt
tttttttttaagagacagtatcttgctctgccacccaggctggagtgcagtggcacaatc
atggctcactgcagccttgacctcctgggctcaagtgttcctcccacctcagcccccaac
ATGCCCCGCCTCCTCTCCCCCCACTCCCCCCGCCCCTCAGTATCGGGGACCACAG
gtgagtaccaccacgcgcagctaagttttgcatgttttgtagagctgggtttttaccgtg
ttgcccaggctggtctcaaactcctgggctgaagcaattctataccttatgaaggcagct
aatatttctgttctaagaagggaatgagggctggacatggtggctcacacctgaaatccc

 3.02 Intr +  33834  33897   64  1  1  110   89    24 0.154   1.56
cttattctcccaaactctcatgtccagtcatgttgcttcaactcctcggtgcactgcttc
ctgctgtttcctaggattccaggaccaggctcatctctctctccttcttacccccacctt
tgtcttccagcaactccaccctcctagtagttcccttaatacgccccattccctctacag
GTGGTGACTCTGCAGATCCTCCTCCTCTGGCTCTGCCGTTGCCCACCCCCTCCCCCTGCC
ACAG
gtgtgtctgcctctacacacgtccatttgcctatttcacatgggttgtagtcgtgtttcc
tccctgagagactgtacctctctgtgaacagatgccctatgttatttctataagtcctca
gtaactagtaaagagtagacacttaaatactgacttgtttttaaggttcttgaaacatta

 3.03 Intr +  53034  53061   28  0  1   63  100    29 0.094  -1.20
tcattaattaaaatcttttacagttgatgggttttgtcaagataaattgtattcccttga
cagctttatgtctttttaccaagggtgtggttgtgtctttgtgtgtgtgtgtctctgtgt
gtatgtgcgtgtgtaaagtaattggaatcattttaagattgtctttcatgtattgtacag
ACTTTTCATTGATGGGGCAGTTACTGAA
gtaagtaggttctgtacattcagtagggtttactgaaatcataagctaagatagaattaa
aattaataattgagaatatgtattaagagcttgatataaatttatcagattatgttctgt
ctaaagaaatgactcattttcatattaaaaggctggttttcttaagattagctttcagtc

 3.04 Intr +  59135  59287  153  1  0   58   92    94 0.305   6.15
ttactaggataattatgaccatttaactttgaaaatacatagcaaaatattaagacaaag
aaattctggcattctatctctggcctttctgatgtataacttaaaagatatatgtttagt
caatgtgttatgaacttttgctttgttttttgttttgttttgttttgtttttaatatcag
GCTGCCTATGTGTTATCCAAATACCAGTACTTTGTCTGCCCAGTGGAATACCGAAGTGAT
GTAAACTCCTTCGTGACAGAATGTGAGCCCTCAGAACTTTTCCAGCTTCAGACTTACTCA
CTTCCACCCTTTCTAAAGGCAGTCTTGAGACAG
gtacagtaaaagttcaagataaacatggttagagatcttccactctgaagattaagcttc
ctttattatttatttatttatttaattaatttattgttgttttgagacagagtttccctc
tgttgcccaggctggagtgtagtggcgtaatctcaacttactgcaacctttgctcaagtg

 3.05 Intr +  61321  61440  120  0  0  136   93    77 0.961  12.77
ggatggtacagaaggcttaaatagacttttcttccttgatccttaaagtttgaaaaatta
acaaaaatgtggtgcgtgctttgacttactatttacacaatggttcttagatcaggtggt
atgctcaaatacaatttcagtgaaattagcccctctcctccccttctttctcctctttag
GAAAGAGTGAGCTTGTACCCTTTCCAGATCCACAGCATTGCACTGTCAACCTTTGCATCT
TTAATTGGCCCATTTGGAGGCTTCTTTGCTAGTGGATTCAAAAGAGCCTTCAAAATCAAG

gtgtgtgtttagattctttgttatattattagagaatataattagagaatgtaacctagt
tggaatttggtccgctcatgatctacattaagcccctaggccacaacttttatatcctat
ttgtttcgaccccacagaaatgctgccacgttgatctgaatgtattctttctttttaggt

 3.06 Intr +  68119  68236  118  0  1   56   66   116 0.030   5.32
ccaatgcctcactcctggcttctagtgcagccctttgtagactcacctcgcaagaaggaa
gatctgcctggagacctgatcccagtccagctttttgaccataggtcatctttgtcccct
tgctcctttgcatcatgtcataaaatttgaggatatcagctgattattttttcttccaag
AATGAAAATCAAGCAGAATTGATTCCTACACGAAAAAAAAGCACACGAATGCCAAACCTT
TCCTTTGGTGGACTGGACACTAACCAGATGAGAGTAAATTTCTTATCCGTGGACGTAT
gtaagctactgctgctgtgtgctctccacagccatatttattgtattaaacaatcagcac
taaaccttcaaaaattgcccagtgttcctagttaaatgttcagaggggagaaatagatat
attttaaataatgttttgctaatgaaaagagtaaatatttttgtttaaatcagcaaaaac

Predicted peptide sequence(s):


>CDS1_1|GENSCAN_predicted_peptide_1|149_aa
NPACSSGFGVLEEAATAARERKMLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSD
KVSGAERGGRRALAGSWLEAGHLRARVGPVQRQGVGTRDPSGGEVPRMTAAAAREKWATQ
PGLQFSFILFRSLLQDLGPTLESGGNLSS

>CDS1_1|GENSCAN_predicted_peptide_2|64_aa
MAIPATRSLLLNGDIPNTQSHNTERDWNTSELSFLGSVIGNDQKPHPITRITTERCLLSD
QQQH

>CDS1_1|GENSCAN_predicted_peptide_3|180_aa
MPRLLSPHSPRPSVSGTTGGDSADPPPLALPLPTPSPCHRLFIDGAVTEAAYVLSKYQYF
VCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLYPFQIHSIALSTFAS
LIGPFGGFFASGFKRAFKIKNENQAELIPTRKKSTRMPNLSFGGLDTNQMRVNFLSVDVX