GENSCAN 1.0	Date run: 16-Jan-104	Time: 10:13:49

Sequence ABCE1_1 : 33245 bp : 35.28% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -   1088    987  102  2  0   73   74   195 0.444  16.89
 1.00 Prom -   2246   2207   40                              -5.15

 2.01 Init +   7280   7382  103  1  1   54   94    83 0.667   5.95
ttacaatttttacatttgtcaaaatttatattttttttttgcagataatcatttcatctc
catataatgatcatttatgttttcctgtctttcatgtatgcaaattagttcccttaacta
atggcattaaatttgttgatttttctttcatagaagagctggatattctttcgcccagtt
ATGGCAGACAAGTTAACGAGAATTGCTATTGTCAACCATGACAAATGTAAACCTAAGAAA
TGTCGACAGGAATGCAAAAAGAGTTGTCCTGTAGTTCGAATGG
gtaagctgttctgtggatcatttaagtataaaagaaaaccatgaaagaaatcaactggtt
tgataattctttacggacattaacataaactttgtgttcaccattagtttcataaaactg
tgaagacaagaaaagtagtttgttctaaatttcttttattgctttgtgactgaaggatca

 2.02 Intr +   8472   8557   86  1  2   76  115   -11 0.796  -0.98
aaatctgtccccacaaagcactgatttaagacattatctcaaatgtatttctttgtgtgg
cctttgtttttgaaaatctgcttctgtatggaaatttagaaccagcattgcctaaataac
agtgttcggaaaattagaagatcaaaggaaatggcttaattatatcttttcctttaccag
GAAAATTATGCATAGAGGTTACACCCCAGAGCAAAATAGCATGGATTTCCGAAACTCTTT
GTATTGGTTGTGGTATCTGTATTAAG
gtaagtaatattttatttactggatcaaacgtgtaacctaaaactgaaatctgaaaattc
tggatactatgctataactactttaagtgaggcaaagtataaagcaaatgaatagagaat
gtaaatttaggaaagtggtattctaatatcagtgacattgttgcttttttaaataaatta

 2.03 Intr +  10882  10979   98  0  2   45   76   107 0.753   3.09
attctaatgttcaaggaaccttttattttaagtaaatagtagaaggaaatgaaacaacat
ttcacatctttatgaaatcatgtttagaagattgcttataaaaatatttttaatccattt
tagttatgtgtatatgtctacaaattaatacaaaaattaattctttactttaaataacag
AAATGCCCCTTTGGCGCCTTATCAATTGTCAATCTACCAAGCAACTTGGAAAAAGAAACC
ACACATCGATATTGTGCCAATGCCTTCAAACTTCACAG
gtatattttcacatcaggattcctcttctgtcaagttaagagtaaaatacatttgggatt
ttaagagaagtgcagaaattggggggaaatgctattaaccagtcactaaaggaaaataca
atattataacatcatgcagaatcatactgcatatgtctgtggttcattctggctaacatt

 2.04 Intr +  11999  12116  118  2  1   68   42    66 0.842  -0.45
ctaatagccattaatcttggctgtttttttcctaatagccagtaatatctggcatatgtt
tcttagcttattaatggatggttgtgaagtgcaggtgcattaaaatatatcattctgatg
ttatgtggctttttctgtgtaaatctgagttgttttattatttttgtatacttgtaacag
GTTGCCTATCCCTCGTCCAGGTGAAGTTTTGGGATTAGTTGGAACTAATGGTATTGGAAA
GTCAACTGCTTTAAAAATTTTAGCAGGAAAACAAAAGCCAAACCTTGGAAAGTACGAT
gtatgtattatcaccttgtaaaaattaatatcatgagtcagttttatgagattttggggg
gatgatatgtatatttttaaaatattcttattttcaaaattatttatggaattaatgctg
agaaatttataaacaaagctcttttgtacttttgaactaaaaatctgttaatgttactta

 2.05 Intr +  12970  13107  138  0  0  121   71   100 0.997  11.34
tgttttctttctttgctgctatagggaaatgagacttttattaattatgttcgcctccaa
ccttaagttaaaagccacaagtgttctatttgcatatataatctatttcctgtagcattc
atcctctttgtcattgtattattaaattcacatgattctgtattttttttttttttttag
GATCCTCCTGACTGGCAGGAGATTTTGACTTATTTCCGTGGATCTGAATTACAAAATTAC
TTTACAAAGATTCTAGAAGATGACCTAAAAGCCATCATCAAACCTCAATATGTAGACCAG
ATTCCTAAGGCTGCAAAG
gtcggtttttgatagagggaacttaacggatattagtagaagtataaaagatatatcaaa
ataaacttgttttactttgtgattctttttaatattgaaagaaaatagtaactgtttttg
gtatattgtggcaggggacagtgggatctattttggaccgaaaagatgaaacaaagacac

 2.06 Intr +  13242  13311   70  2  1   42  111    91 0.924   4.64
catcatcaaacctcaatatgtagaccagattcctaaggctgcaaaggtcggtttttgata
gagggaacttaacggatattagtagaagtataaaagatatatcaaaataaacttgtttta
ctttgtgattctttttaatattgaaagaaaatagtaactgtttttggtatattgtggcag
GGGACAGTGGGATCTATTTTGGACCGAAAAGATGAAACAAAGACACAGGCAATTGTATGT
CAGCAGCTTG
gtaagtgtttattttttgtttgtgtgaatatatatttatttattttttgagacggagttt
cgctcttgttgcccaggctggggtgcaatgatgcaacctctgcttaccacaacctctgcc
tcccgggttcaagcgatactcctgcctcagcctcccaagtagctgggattacaggcatgt

 2.07 Intr +  13835  13931   97  0  1   79   42    84 0.909   1.05
ctgaacttaagtgatgaaagtacacatctttatgtggattactgaaaatctccagtaatt
gttatatttaaacaattttcaactgaaatagcattcaaacttcaaatgatgacatgcagt
atactttttacctggaagaggtgaaatacattgagcacaatgcctctatgttctttgtag
ATTTAACCCACCTAAAAGAACGAAATGTTGAAGATCTTTCAGGAGGAGAGTTGCAGAGAT
TTGCTTGTGCTGTCGTTTGCATACAGAAAGCTGATAT
gtaggttactttacaatttttgtttatcttcatccgtattgtagagttttcagttgtgat
gctgctaatagaggaatggttttgagagaaattaatagaaatagtatctaagttcctaat
ttcgaggtaagatgttgaagcagttgtgtatccactactcattttccctgttatattcac

 2.08 Intr +  15106  15195   90  1  0   77   97    86 0.981   6.59
tctacttctgaacagaatacagaaatttttaccattacaagtagactcttcattactatt
ggagatttgtgttgtggttaactcaaaagctcttgatactacagtgctttaaaatagtat
gtaaggtagaatgtcttgtctttcaaacttatatttgctttttttttttttttttcatag
TTTCATGTTTGATGAGCCTTCTAGTTACCTAGATGTCAAGCAGCGTTTAAAGGCTGCTAT
TACTATACGATCTCTAATAAATCCAGATAG
gtaagtagagatctggcatattactgtgttgttttgtttggagatttttacagatttcta
aggattaaacactgggactgtcaatgtgatgtacatattttttatcttggttgtttatag
ctgccacctaaatttacctttctttacctagaacagaggttctcaatgcaagattcattt

 2.09 Intr +  20160  20281  122  0  2   53   88    66 0.964   2.32
gttcaggaaaacatttttaaatatgagcattgataatgagccttactaaaaatgttttat
ggcttttgcttcttatgtctttatgcttaaattttattagatgtatctctttttctgaaa
tttccaactattaaaaatagttatgtaagagttttaactaaaatctggtttgattttcag
ATATATCATTGTGGTGGAACATGATCTAAGTGTATTAGACTATCTCTCCGACTTCATCTG
CTGTTTATATGGTGTACCAAGCGCCTATGGAGTTGTCACTATGCCTTTTAGTGTAAGAGA
AG
gtaacttgaaaaacttttttcacatatgctgtattctcttctactctaatgcttataaac
tacattattgatattaagtagttttacattggtctgatatcatccaaaactctagttcct
tggaatttaatcactgagcatataaggttatatatatcagttgttatacaaaatatattt

 2.10 Intr +  22799  23020  222  0  0   79  115    82 0.602   7.18
tgaattatttaaacttacattaaatatatatagttttttaagttacttctttatatgcag
accaacatgttagcaaaaatccacagaaatttaaagtatatagtctatagattgctccca
agagagcttaggattttggctctaatgatttctcccggttgacaattttcttcccaacag
GCATAAACATTTTTTTGGATGGCTATGTTCCAACAGAAAACTTGAGATTCAGAGATGCAT
CACTTGTTTTTAAAGTGGCTGAGACAGCAAATGAAGAAGAAGTTAAAAAGATGTGTATGT
ATAAATATCCAGGAATGAAGAAAAAAATGGGAGAATTTGAGCTAGCAATTGTAGCTGGAG
AGTTTACAGATTCTGAAATTATGGTGATGCTGGGGGAAAATG
gtaagttttctgttttgtgataagtaaaaatcttcctgtttatctagtaaattagtttta
actgttttgtggaaaaatttgaatcatatgttatagggctagaagcagagttttatttaa
acccacaaatttcttagtgtactttcacatttttttggcattgtgtaattcaatttcact

 2.11 Intr +  24041  24100   60  0  0   58   73   100 0.829   3.29
atgacacttcagaggtgagccatgaaagacttaagtatttttctatataaacttcagaat
tcaataatgtcagtgtatatctttaaaacaaatttctcagttaaaaccaaataggacata
gtgatttactttaaacgtcaagcatctttcagatcaaactgtcatatgttgtgttgccag
GAACGGGTAAAACGACATTTATCAGAATGCTTGCTGGAAGACTTAAACCTGATGAAGGAG

gtacatttgtaactgttgagtctttttactctgttttacacagtaaactttaaagatctg
ggcagtttttagtgtcttatgtatttcattattttgcaggagaagtaccagttctaaatg
tcagttataagccacagaaaattagtcccaaatcaactgtgagttattattttttatatg

 2.12 Intr +  24200  24258   59  0  2   78   74    -9 0.900  -5.62
tgtcatatgttgtgttgccaggaacgggtaaaacgacatttatcagaatgcttgctggaa
gacttaaacctgatgaaggaggtacatttgtaactgttgagtctttttactctgttttac
acagtaaactttaaagatctgggcagtttttagtgtcttatgtatttcattattttgcag
GAGAAGTACCAGTTCTAAATGTCAGTTATAAGCCACAGAAAATTAGTCCCAAATCAACT
gtgagttattattttttatatggttactaaagaaaattttgtatatatgcctatagcttt
catcttttactatattaaaatttttctccaaattagattctatacagttttattgatagt
tgcaaacaaatgtattaagagtccaatccttgattcatatccactgctaagaaagtgctt

 2.13 Intr +  25888  25998  111  0  0   39   65   164 0.996   8.86
acatgatgggttttgaatagaaaatctcaaaacatgtcatagatggtggatacacattga
tatctgttggtggcaaattgatatacttttattctgaagcttaactttgtcaagattcat
aaatagaagagttctatagtgaaagtttatcatttaaatacttttttatattaaaaacag
GGAAGTGTTCGCCAGTTACTACATGAAAAGATAAGAGATGCTTATACTCACCCACAATTT
GTGACCGATGTAATGAAGCCTCTGCAAATTGAAAACATCATTGATCAAGAG
gtactttaacataattttttttatttttttattattttgaattttggatgcctttacatg
gtttgctaaactcctccaattaggtgcagacattatctggtggtgaactacagcgagtag
ctttagccctttgcttgggcaaacctgctgatgtctatttaattgatgaaccatctgcat

 2.14 Intr +  26082  26224  143  2  2   42   51   183 0.880   8.23
gttactacatgaaaagataagagatgcttatactcacccacaatttgtgaccgatgtaat
gaagcctctgcaaattgaaaacatcattgatcaagaggtactttaacataatttttttta
tttttttattattttgaattttggatgcctttacatggtttgctaaactcctccaattag
GTGCAGACATTATCTGGTGGTGAACTACAGCGAGTAGCTTTAGCCCTTTGCTTGGGCAAA
CCTGCTGATGTCTATTTAATTGATGAACCATCTGCATATTTGGATTCTGAGCAAAGACTG
ATGGCAGCTCGAGTTGTCAAACG
gtaaatatcttgctcctagccatattttgattatgtatactgtcctacaagtgtgcttaa
tataacagtcgaatgttttatgatagaaagctataagatttcaaaatcattgtgttttag
tttcatactccatgcaaaaaagacagcctttgttgtggaacatgacttcatcatggccac

 2.15 Intr +  26345  26467  123  2  0   15   98   150 0.962   7.48
tgaaccatctgcatatttggattctgagcaaagactgatggcagctcgagttgtcaaacg
gtaaatatcttgctcctagccatattttgattatgtatactgtcctacaagtgtgcttaa
tataacagtcgaatgttttatgatagaaagctataagatttcaaaatcattgtgttttag
TTTCATACTCCATGCAAAAAAGACAGCCTTTGTTGTGGAACATGACTTCATCATGGCCAC
CTATCTAGCGGATCGCGTCATCGTTTTTGATGGTGTTCCATCTAAGAACACAGTTGCAAA
CAG
gtaaaattactttttaatatgttcaaagtaattcattttaaattttccagtaaatagtaa
agtcactcactttaatttttaaaaaatgaaagctagaaattctagacttgattctgtgac
tcctgagatcattggtattggggactggatgggaccatgtggaagagtagtgtttaggct

 2.16 Intr +  27857  27968  112  2  1   85   95    25 0.928   2.36
agtccaagcaaagctatttctgaacacaggatttgtaatatgctgttattatactgttat
ccagatgatttatgattggggaatttgaggtaatagtaattcttaatacccttcctctca
aaaggtagttacatttctgaagtaaaatttaatcaaaattgatttttttttttctcttag
TCCTCAAACCCTTTTGGCTGGCATGAATAAATTTTTGTCTCAGCTTGAAATTACATTCAG
AAGAGATCCAAACAACTATAGGCCACGAATAAACAAACTTAATTCAATTAAG
gtatgtagaaaagttgtcttaaatcatggattactgatctcagtataaacacttgaaagg
ctatttaaaaatcaataacatatggctgggcacagtggctcacacctgtgattcaagcac
ttttgggaggccaaggcaggcagatcacttgaggtcacgagtttgagaccagcctggcca

 2.17 Term +  30393  30440   48  2  0  109   38    60 0.890  -0.57
aggtagttatctttcctttgagcagtggacccaggaatatccagaaacagatggtatgtg
cagaacaggttgtacaggcactgttttaagcacagctaagtaataccatgagtgaaagtc
tacttttacctatagtagaatcgtgttgctgatttttgtggcttctgttttcttttttag
GATGTAGAACAAAAGAAGAGTGGAAACTACTTTTTCTTGGATGATTAG
actgactctgagaatattgataagccatttattaaaaggagtatttactagaattttttg
tcatataaaacttgaatcaggattttatgccccacatactctggaacttgaagtataata
tacttaatataacataaaaagccagttgggttctaaattgtagttgaaacacagaaaatg

Predicted peptide sequence(s):


>ABCE1_1|GENSCAN_predicted_peptide_1|34_aa
MTSLSCDPCSTPLAKPAAGGAENLSFGKQPGLET

>ABCE1_1|GENSCAN_predicted_peptide_2|599_aa
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD