GENSCAN 1.0	Date run: 16-Jan-104	Time: 05:42:01

Sequence ZNF148_1 : 145574 bp : 37.13% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +    912   1325  414  2  0   92   47   196 0.383  10.18
gcaaataacctttcacctaggtccccgacccttccatttccccaggcctgaaacgctccc
gaatccccgagtcctccactttccaagcgctgggcattggttaaggctgtaggagcaggg
agtcccccgctctaagagagttcctcagttccgatctttttcaaaccgctttcctcccag
GCCCAGCCTGGGGGGCCTGCGGCTCGGGTCCAGCTTCCACGGCCACCCTGGGCTGGTGAC
ACGCAGGCGCCGGAATCGAAGCCACGCTGTGTCTTTCCAGCCAGGTCTCTGCGCCAGACG
AGGGCGGGCGCCGCGGAGCGCTTCCCGTGTGCGGGGCTTCCCACAATGCACCGGGCCGGC
AGTGGCGGCGACCGCGGCGGCGCTCTAGCTGCGGCATGTCTGCGTCTCTACTGCTCTGGG
AGGAGGAAGAGAAGGAGGAAGAGGAGGAGGAGGAGGAGGGGGAGGAAGAGGAGAAAGGCG
CAGGGGTGGGAGCTGTTGCCGAAGCTGCCACAGCAAAAGTTCTCCCCCCTCCCCCCTTCC
CCTCCTCTCAAGGCCCCTAGAAAGGTTGGAGCTGCCGCCGCCTGCAGTCGGTGA
ccgcgcgactcggcgcccgcccgcggtaaagcgctcggcctggcaggcccgggcccgggg
gagggcgggggagggggagggggcggcgcgcggggggagcgcgcggcggtaacggcctga
ccccggggggagcgagccgtggcgaggctgggggtggccagggggccagccgaggccgag

 2.06 PlyA -   3044   3039    6                               1.05
 2.05 Term -  18977  18784  194  0  2  100   55    88 0.410   3.30
 2.04 Intr -  19156  19010  147  2  0  140   64    48 0.200   6.89
 2.03 Intr -  19440  19246  195  1  0  -13   41   171 0.207   0.76
 2.02 Intr -  25925  25760  166  2  1   42   64    55 0.047  -2.89
 2.01 Init -  31030  30890  141  1  0   55   52   107 0.381   3.98
 2.00 Prom -  55833  55794   40                              -3.45

 3.01 Init +  62812  63144  333  0  0   62   95   386 0.958  34.04
tggaaaccgatattggtattataattttaaaattggaggcagttccaaagtacatcaata
aaatctttgtatttgaatgttcaaattcttaatttgaaaatttaaaatgaagtagtcata
taaaactaatttactatgttttgttgccaaacttggttttctaggcagttatacttaagc
ATGAACATTGACGACAAACTGGAAGGATTGTTTCTTAAATGTGGCGGCATAGACGAAATG
CAGTCTTCCAGGACAATGGTTGTAATGGGTGGAGTGTCTGGCCAGTCTACTGTGTCTGGA
GAGCTACAGGATTCAGTACTTCAAGATCGAAGTATGCCTCACCAGGAGATCCTTGCTGCA
GATGAAGTGTTACAAGAAAGTGAAATGAGACAACAGGATATGATATCACATGATGAACTC
ATGGTCCATGAGGAGACAGTGAAAAATGATGAAGAGCAGATGGAAACACATGAAAGACTT
CCTCAAGGACTACAGTATGCACTTAATGTCCCT
gtaagtaattcctttataagatattaaacttagaaacataattttttgttacgtaatact
gcaagtcatcgaagaaatttcagaaaatgtttcagggctaaatagtgttcttgaatagat
atactaaaatattgacataaatcatatttgaaaggcaaaattaagttcttgtattatatt

 3.02 Intr +  83771  83992  222  1  0  103   88    64 0.130   5.30
actgtatacttttaagggaaagagagttttaaaaagcagctactattgtgaaagtagttt
tgatgtcatgaatgacctgaaagggcataagggaccttcaggagtccccatgctatgctg
gctgtttcttgcaagttctaaaacatctcttaattaccctgacctttttctcattttcag
TCTTTCCTTTTTTATTCTCCCGACTTTAAACATAAAGAGTTAAGAACCACTGATGTAGAT
TTACTGAAACTGTTACAAAATACAGGCACATATTACTGGAAGGATGGATCCAGAAGAACT
GCTATGAAGAAAAGGAGAGAACTTAAATTAGGTGATTTTATGGAACTTGGAAGACTAGAA
TTTCCAAGTAGGATAGGGATGGTCAGCACTGTTTCAGGTAAG
gtaacttgatttgatcagttcatctagttaatctttaattatgtaaactataagatgctg
atatagtaaccagagtttacatttatagtgagaaatgtaatagggaaatagatcagaatg
tttgtttccaactgtggctctctgaaccttttcgaaaatcaaaggatagctgtggacttt

 3.03 Intr +  88224  88349  126  2  0   78   69   164 0.899  13.46
tattacccactgcctattaatgaattctatagcactgtatatagttaggacacacacaca
tagatcatcattctggaagcacctgtatgtgggtttagcaaaggattaaacataaaatgg
ccttttgtcacaatgaactttttatttatgtctaaaattggcttttctttttttaaacag
ATAAGCGTAAAGCAGGAAATTACTTTTACTGATGTATCTGAGCAACTGATGAGAGACAAA
AAACAAATCAGAGAGCCAGTAGACTTACAGAAAAAGAAGAAGCGGAAACAACGTTCTCCC
GCAAAA
gtaagacaatgtattaaggtggtaatcacaacctcttaattccaactgttggttaattct
ataggcaagaacctggctggaccctaaggcagatgtagaagtcttgtgtggtttagtagg
agggggtgcgtgcctgcatggaggtggtgggccttgctttcaatttttctgcttctcttt

 3.04 Intr +  97205  97328  124  1  1   70   68    18 0.095  -2.76
ttgtactttcctacagttaatgataacattattctaatagtcttttcaagatcatttaag
aacaaaatatttcataatctgtggtgaccgttgtttgcattatcttttttttaaaattac
tatttaattacattttaaaaacttatttcttttgtttttgcctttttttttttgaactag
ATCCTTACAATAAATGAGGATGGATCACTTGGTTTGAAAACCCCTAAATCTCACGTTTGT
GAGCACTGCAATGCTGCCTTTAGAACGAACTATCACTTACAGAGACATGTCTTCATTCAT
ACAG
gtatttcttgaattaaaatgggcttgtggccattaaagttattatctttgttattttcat
cttcgtgtaactgtcattcattcctaagaccatagctaatctggcattccaaatcagaga
ttttgtaggccagaatgtcagaaggaaaccaggaaaaactcttaagtgagaaaacaatta

 3.05 Intr +  98643  98726   84  1  0   38  105    84 0.253   3.97
ttaaatcctgggaaaaaaattgagaggacataaaattctgttaataacattaaaaatttg
tatggctattttgtaattttccaaaatttgggcatctaagatttttctttcctcagaaac
agtaactaaaaaccgttgttttattcagtaactaatttgtggatgtgaaattattttaag
GTGAAAAACCATTTCAATGTAGTCAATGTGACATGCGTTTCATACAGAAGTACCTGCTTC
AGAGACATGAGAAGATTCATACTG
gtgagtgttaaccacccttactaggttcattaaaatgattatttcaaatggagggaagaa
tttttaataagtggcagtgacttgctgccatttccattggtttagactataaatcacagg
ttatcttttttctcccttcaataaatcaatgttaactgttaagacttaactttaatgtcc

 3.06 Intr + 142123 142241  119  2  2   66  110    55 0.667   4.76
tccttttctttccaatagcatatgctaatccttttcatttttataaagcaaaatatattt
gacaaatgaaattggaagttacaactttcaaaagccatttattttagagattcttatggc
aaagcaattcattattttacaatatttgttttgttttaaactttctatattatgtgctag
GTGAAAAACCATTTCGCTGTGATGAATGTGGTATGAGATTCATACAAAAATATCATATGG
AAAGGCATAAGAGAACTCATAGTGGAGAAAAACCTTACCAGTGTGAATACTGTTTACAG
gtaagagagatggcttgaaattcttctactgtaattaaattatacaataattataaatta
gattagaaaatattacaacttagagctatttaaggggccttctaactcttacagattaga
tttataatagaaaattggctcagtgaatttgtttggaattatgtatgttattgcattaat

 3.07 Term + 142513 144111 1599  0  0   27   42  1361 0.780 114.54
aaggggccttctaactcttacagattagatttataatagaaaattggctcagtgaatttg
tttggaattatgtatgttattgcattaatatatctttatattaattgttttgtttcactt
tttcttttcttggttgaccaaaaccacaaacaacccactaccatcctctgaattcaacag
TATTTTTCCAGAACAGATCGTGTATTGAAACATAAACGTATGTGCCATGAAAATCATGAC
AAAAAACTAAATAGATGTGCCATCAAAGGTGGCCTTCTGACATCTGAGGAAGATTCTGGC
TTTTCTACATCACCAAAAGACAACTCACTGCCAAAAAAGAAAAGGCAGAAAACGGAGAAA
AAATCATCTGGAATGGACAAAGAGAGTGCTTTGGACAAATCTGACCTGAAAAAAGACAAA
AATGATTACTTGCCTCTTTATTCTTCAAGTACTAAAGTAAAAGATGAGTATATGGTTGCA
GAATATGCTGTTGAAATGCCACATTCGTCAGTTGGGGGCTCGCATTTAGAAGATGCGTCA
GGAGAAATACACCCACCTAAGTTAGTTCTCAAAAAAATTAATAGTAAGAGAAGTCTGAAA
CAGCCACTGGAGCAAAATCAAACAATTTCACCTTTATCCACATATGAAGAGAGCAAAGTT
TCAAAGTATGCTTTTGAACTTGTGGATAAACAGGCTTTACTGGACTCAGAAGGCAATGCT
GACATTGATCAGGTTGATAATTTGCAGGAGGGGCCCAGTAAACCTGTGCATAGTAGTACT
AATTATGATGATGCCATGCAGTTTTTGAAGAAGAAGCGGTATCTTCAAGCAGCAAGTAAC
AACAGCAGGGAATATGCGCTGAATGTGGGTACCATAGCTTCTCAGCCTTCTGTAACACAA
GCAGCTGTGGCAAGTGTCATTGATGAAAGTACCACGGCATCCATATTAGAGTCACAGGCA
CTGAATGTGGAGATTAAGAGTAATCATGACAAAAATGTTATTCCAGATGAGGTACTGCAG
ACTCTGTTGGATCATTATTCCCACAAAGCTAATGGACAGCATGAGATATCCTTCAGTGTT
GCAGATACTGAAGTGACTTCTAGCATATCAATAAATTCTTCAGAAGTACCAGAGGTCACC
CCGTCAGAGAATGTTGGATCAAGCTCCCAAGCATCCTCATCAGATAAAGCCAACATGTTG
CAGGAATACTCCAAGTTTCTGCAGCAGGCTTTGGACAGAACTAGCCAAAATGATGCCTAT
TTGAATAGCCCGAGCCTTAACTTTGTGACTGATAACCAGACCCTCCCAAATCAGCCAGCA
TTCTCTTCCATAGACAAGCAGGTCTATGCCACCATGCCCATCAATAGCTTTCGATCAGGA
ATGAATTCTCCACTAAGAACAACTCCAGATAAGTCCCACTTTGGACTAATAGTTGGTGAT
TCACAGCACTCATTTCCCTTTTCAGGTGATGAGACAAACCATGCTTCTGCCACATCAACA
CAGGACTTTCTGGATCAAGTGACTTCTCAGAAGAAAGCTGAGGCCCAGCCTGTCCACCAA
GCTTACCAAATGAGCTCCTTTGAACAGCCCTTCCGTGCTCCCTATCATGGATCAAGAGCT
GGAATAGCTACTCAATTTAGCACTGCCAATGGACAGGTGAACCTTCGGGGACCAGGGACA
AGTGCTGAATTTTCAGAATTTCCCTTGGTGAATGTAAATGATAATAGAGCTGGGATGACA
TCTTCACCTGATGCCACAACTGGCCAGACTTTTGGCTAA
aaaaaaaaaaaaagtgtaaataatactggcactttagaacagattaatcaagagtggggt
tactctgtgtaaatggagtgctgtacagatttaagagcaatgcgtaataacaagttaagc
tgatatgaatagcaagataatccaataactgcatttcgtttggttagtcagcattctttg

Predicted peptide sequence(s):


>ZNF148_1|GENSCAN_predicted_peptide_1|137_aa
AQPGGPAARVQLPRPPWAGDTQAPESKPRCVFPARSLRQTRAGAAERFPCAGLPTMHRAG
SGGDRGGALAAACLRLYCSGRRKRRRKRRRRRRGRKRRKAQGWELLPKLPQQKFSPLPPS
PPLKAPRKVGAAAACSR

>ZNF148_1|GENSCAN_predicted_peptide_2|280_aa
MRKDVEPVIELPKETKKEQNEAKARRKELLKEEIKEENRENQLSKKFHQGLVSRKTIFQW
VKDGFRMKLFHLRSSGIRFSKGACKTDSSPAPLKIGFTLLREFQQKICKRGIRRKTGVHH
QPSAAPPLSGGHLLVAAEKPLTKFPIPLREGVLTAPAGQAQKARYLGEGRTRTDTRTHAR
TYTQKEVMEGAGPCIQAHSRGTHTHPPKRGVRGSPDGPAHFRERPLAQPRAKSARTQAGG
SPPATTQLHFAVPQPPTAQPAQSRPRSWPNRAWAAKAQGI

>ZNF148_1|GENSCAN_predicted_peptide_3|868_aa
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDRSMPHQEILAA
DEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERLPQGLQYALNVPSFLFYSPDF
KHKELRTTDVDLLKLLQNTGTYYWKDGSRRTAMKKRRELKLGDFMELGRLEFPSRIGMVS
TVSGKISVKQEITFTDVSEQLMRDKKQIREPVDLQKKKKRKQRSPAKILTINEDGSLGLK
TPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQCSQCDMRFIQKYLLQRHEKIHTGEKP
FRCDECGMRFIQKYHMERHKRTHSGEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLN
RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYL
PLYSSSTKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRSLKQPLE
QNQTISPLSTYEESKVSKYAFELVDKQALLDSEGNADIDQVDNLQEGPSKPVHSSTNYDD
AMQFLKKKRYLQAASNNSREYALNVGTIASQPSVTQAAVASVIDESTTASILESQALNVE
IKSNHDKNVIPDEVLQTLLDHYSHKANGQHEISFSVADTEVTSSISINSSEVPEVTPSEN
VGSSSQASSSDKANMLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSI
DKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFL
DQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEF
SEFPLVNVNDNRAGMTSSPDATTGQTFG