GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:05:12

Sequence WDR6_1 : 10959 bp : 56.46% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    495    703  209  1  2  100  -37   306 0.048  18.62
ccagtagtgttgactatacattagtgggctgagatgaggagcctccaaggaagctttagg
tctgggtgtttgctacacaaggaatgcatagctggacccaccttggtcatgctcttggtg
cctatgaggccaagctctggccagcccagcctaggatctcacgtcaccctcctcttctag
GTTGGGTGGGTGACGTAGACGACTACTCGCTGCACGGGGGCTGCCTGGTCACGCGCGGCA
CCAAGTGGATTGCCAACAACTGGATTAATGTGGACCCCAGCCGAGCGCGGCAAGCGCTGT
TCCAACAGGAGATGGCCCGCCTTGCCCGAGAAGGGGGCACCGACTCACAGCCCGAGTGGG
CTCTGGACCGGGCCTACCGCGATGCGCGC
gtggaactctgagggaagagttagccccggttcccagccgcgggtcgccagttgcccaag
atcaggggtccggctgtccttctgtcctgctgcagactaaaggtctggccaatgtcttgc
cccaccccgccagccgcgatacggcgcagttcctatattcatgttatttattgtgtactg

 1.02 Intr +   1135   1339  205  0  1   37   76   138 0.048   6.80
aaacagagtccgcgataggtgcagcgggctggcagctgggagcgccccgcaagcgtcacg
tgagggggcgaggggcgggatgcccctccgcgggccccgccaatgatgagctggattgcg
tgggacgaagggtcgtcattggacaaccgccgcgggcgccctggtctctgctacctgtag
CTGAGGGCGCTGTTGATGGGCAGCGCGGCGCGCTGGGAAGGCTCGTTCTCGCGAGAGTTC
AGCTCCCTTCTTAGCCGTGGCTGCCTCAGCACCTCGAGGATCGACATGGACGCTCTCGAG
GACTACGTTTGGCCGCGGGCAACCTCGGAGCTTATACTCCTCCCAGTGACGGGTCTGGAG
TGCGTGGGGGACCGGCTGTTGGCGG
gtgaggcttggcttgaggcacgcctggtggaaagggggaaagaaacagcgcctcccaggg
gcggtgccacagggacaaaaggggtgccctgaggagaaggacgggcagcaggttgaggcc
gatcggaggtgggaagggagccccggagatggcggggacgagggccaacctgaagagggc

 1.03 Intr +   5443   7924 2482  2  1  104   90  1510 0.915 141.19
caggcgtgagccaccgcacccggccgagaccaaggattttctaagattcaagctgcagga
ttgtgtgtcctgatgcattcataggctacatgccgagaagtttccctgatccccatctct
tccctgtgggtcatcagagttaggtacctagctctgacatggctctttgcctctatctag
GTGAGGGTCCCGATGTCCTGGTGTACAGCTTGGACTTTGGTGGGCATCTGCGGATGATAA
AGCGAGTGCAGAACCTGCTTGGCCACTATCTTATCCATGGCTTCCGGGTACGGCCAGAGC
CTAATGGAGACCTTGACTTGGAGGCCATGGTGGCTGTGTTTGGAAGCAAGGGACTCCGAG
TTGTGAAAATTAGCTGGGGACAGGGCCACTTCTGGGAGCTTTGGCGCTCTGGCCTGTGGA
ACATGTCTGACTGGATTTGGGATGCACGCTGGCTTGAGGGAAATATAGCCTTGGCCCTGG
GCCACAACTCAGTGGTGCTATATGACCCTGTAGTAGGGTGCATCCTGCAAGAGGTGCCCT
GCACAGACAGGTGCACCCTCTCTTCAGCCTGCCTGATTGGAGACGCCTGGAAGGAGCTGA
CCATAGTGGCAGGTGCTGTTTCCAACCAGCTCTTGGTCTGGTACCCAGCAACTGCCTTAG
CAGACAACAAACCTGTAGCACCTGACCGACGAATCAGTGGGCATGTGGGCATCATCTTCA
GCATGTCATACCTGGAAAGCAAGGGATTGCTGGCTACAGCTTCAGAAGACCGAAGCGTTC
GTATCTGGAAGGTGGGCGACCTGCGAGTGCCTGGGGGTCGGGTGCAGAATATTGGGCACT
GCTTTGGGCACAGCGCCCGTGTGTGGCAGGTCAAGCTTCTAGAGAATTACCTTATCAGTG
CAGGAGAGGATTGTGTCTGCTTGGTGTGGAGCCATGAAGGTGAGATCCTCCAGGCCTTTC
GGGGACACCAGGGACGTGGGATCCGGGCCATAGCTGCCCATGAGAGGCAGGCCTGGGTGA
TCACTGGGGGTGATGACTCAGGCATTCGGCTGTGGCACTTGGTAGGGCGTGGGTACCGGG
GATTGGGGGTCTCGGCTCTCTGCTTCAAGTCCCGTAGTAGGCCAGGTACACTCAAGGCTG
TGACTCTGGCTGGCTCTTGGCGACTGCTGGCAGTGACTGATACAGGGGCCCTGTATCTCT
ATGACGTCGAGGTCAAGTGCTGGGAGCAGCTGCTAGAGGATAAACATTTCCAGTCCTACT
GCCTGCTGGAGGCAGCTCCTGGTCCCGAGGGCTTCGGATTGTGTGCTATGGCCAATGGGG
AAGGTCGTGTCAAGGTTGTCCCCATCAACACTCCAACTGCTGCTGTGGACCAGACCCTGT
TTCCTGGGAAGGTGCACAGCTTGAGCTGGGCCCTGCGTGGTTATGAGGAGCTCCTGTTGC
TGGCATCGGGCCCTGGCGGGGTAGTAGCTTGCCTAGAGATCTCAGCCGCACCCTCTGGCA
AGGCCATCTTTGTCAAGGAACGTTGTCGGTACCTGCTGCCCCCAAGCAAGCAGAGATGGC
ACACATGCAGTGCCTTCCTACCCCCAGGTGACTTCCTGGTGTGTGGTGACCGCCGGGGCT
CTGTGCTGCTATTCCCCTCCAGACCAGGTCTGCTCAAGGACCCTGGGGTGGGAGGCAAGG
CTCGGGCTGGTGCTGGGGCACCTGTAGTGGGTAGTGGTAGTAGTGGGGGTGGGAATGCTT
TCACTGGGTTGGGCCCAGTGTCTACCCTGCCCTCTCTGCACGGGAAGCAGGGTGTGACCT
CAGTCACATGCCATGGTGGCTATGTGTATACCACAGGGCGTGATGGAGCCTACTACCAGC
TGTTTGTACGAGACGGCCAGCTCCAGCCAGTCCTAAGGCAGAAGTCCTGTCGAGGCATGA
ACTGGCTAGCTGGGCTCCGTATAGTGCCCGATGGGAGCATGGTTATCCTGGGTTTCCATG
CCAATGAGTTTGTGGTGTGGAACCCTCGGTCACACGAGAAGCTGCACATCGTCAACTGTG
GTGGAGGGCACCGTTCGTGGGCATTCTCTGATACTGAGGCGGCCATGGCCTTTGCTTACC
TCAAGGATGGGGATGTCATGCTGTACAGGGCTCTGGGTGGCTGCACCCGGCCACACGTGA
TTCTCCGGGAGGGTCTGCATGGCCGTGAGATCACTTGTGTAAAGCGTGTGGGCACCATTA
CCCTGGGGCCTGAATATGGAGTGCCCAGCTTCATGCAGCCTGATGACCTGGAGCCTGGCA
GTGAGGGGCCCGACTTGACTGACATTGTGATCACATGTAGTGAGGACACTACTGTCTGTG
TCCTAGCACTCCCTACAACCACAGGCTCAGCCCACGCACTCACAGCTGTTTGTAACCATA
TCTCCTCGGTACGTGCTGTGGCTGTGTGGGGCATTGGCACCCCAGGTGGCCCTCAGGATC
CTCAGCCAGGCCTGACTGCCCATGTGGTGTCTGCGGGGGGGCGGGCTGAGATGCACTGCT
TCAGCATCATGGTTACTCCGGACCCCAGCACCCCAAGCCGCCTCGCCTGCCATGTCATGC
ACCTTTCGTCCCACCGGCTAGATGAGTATTGGGACCGGCAACGCAATCGGCATCGGATGG
TTAAGGTAGACCCAGAGACCAG
gtaatatatgctcctgggcagggtgtggtatgggtcatgcagatgctcccaggcttgcag
gctccacctgacagctgcatgttgtctctgcaggtacatgtcccttgctgtgtgtgaact
tgaccagcccggccttggcccccttgtggctgcagcctgtagtgatggggccgtaaggtg

 1.04 Intr +   8018   8096   79  2  1  123   69   -16 0.726   0.05
catgcacctttcgtcccaccggctagatgagtattgggaccggcaacgcaatcggcatcg
gatggttaaggtagacccagagaccaggtaatatatgctcctgggcagggtgtggtatgg
gtcatgcagatgctcccaggcttgcaggctccacctgacagctgcatgttgtctctgcag
GTACATGTCCCTTGCTGTGTGTGAACTTGACCAGCCCGGCCTTGGCCCCCTTGTGGCTGC
AGCCTGTAGTGATGGGGCC
gtaaggtgagagcatagggcccagtgggacaggagacaaaggaagtaaggttgtctagga
tgcgttctgagctgggccaccccccgccccccaggctctttcttttgcaggattctgggc
ggattctgcagctccttgctgaaaccttccaccataagcgatgtgtcctcaaggtccact

 1.05 Intr +   8207   8307  101  1  2  129   81    69 0.793   9.71
ccttgctgtgtgtgaacttgaccagcccggccttggcccccttgtggctgcagcctgtag
tgatggggccgtaaggtgagagcatagggcccagtgggacaggagacaaaggaagtaagg
ttgtctaggatgcgttctgagctgggccaccccccgccccccaggctctttcttttgcag
GATTCTGGGCGGATTCTGCAGCTCCTTGCTGAAACCTTCCACCATAAGCGATGTGTCCTC
AAGGTCCACTCCTTTACACACGAGGCACCCAACCAGAGGCG
gtgagaggggctggatgatggtcctgcatgggctgggttggggggttcctgttgagcttc
atctctgttattgaccaggctgtcttttcctggctctcaggaggctcctcctgtgcagcg
cagctactgatggcagcctggctttctgggatctcaccaccatgctagaccatgactcca

 1.06 Intr +   8408   8526  119  2  2   83   84    26 0.885   2.31
ctccttgctgaaaccttccaccataagcgatgtgtcctcaaggtccactcctttacacac
gaggcacccaaccagaggcggtgagaggggctggatgatggtcctgcatgggctgggttg
gggggttcctgttgagcttcatctctgttattgaccaggctgtcttttcctggctctcag
GAGGCTCCTCCTGTGCAGCGCAGCTACTGATGGCAGCCTGGCTTTCTGGGATCTCACCAC
CATGCTAGACCATGACTCCACTGTCCTGGAGCCTCCAGTGGATCCTGGGCTTCCCTACC
gtgagtagctaatgtgcaaccatggctacccctcctcacctgtcacatagccctcacaca
tgtggcaggcggggccctgacaactaccctcttcctcttccttcagggcttggcaccccc
tccctgactctccaggcccacagctgtggtatcaacagcctgcacaccttgcccacccgt

 1.07 Term +   8633   9096  464  0  2  141   51   254 0.998  22.60
ctgggatctcaccaccatgctagaccatgactccactgtcctggagcctccagtggatcc
tgggcttccctaccgtgagtagctaatgtgcaaccatggctacccctcctcacctgtcac
atagccctcacacatgtggcaggcggggccctgacaactaccctcttcctcttccttcag
GGCTTGGCACCCCCTCCCTGACTCTCCAGGCCCACAGCTGTGGTATCAACAGCCTGCACA
CCTTGCCCACCCGTGAGGGCCACCATCTCGTGGCCAGTGGCAGTGAAGATGGATCCCTCC
ATGTCTTCGTGCTTGCTGTGGAGATGCTACAGCTAGAAGAGGCTGTGGGAGAGGCTGGGC
TGGTACCCCAGCTGCGTGTGCTAGAGGAATACTCTGTCCCCTGTGCACATGCTGCCCATG
TGACAGGCCTCAAGATCCTAAGCCCAAGCATCATGGTCTCAGCCTCCATTGATCAACGGC
TGACCTTCTGGCGTCTGGGGCATGGTGAACCCACCTTCATGAATAGCACTGTGTTCCATG
TGCCTGATGTGGCTGACATGGACTGCTGGCCTGTGAGCCCTGAGTTTGGCCACCGTTGTG
CCCTTGGGGGTCAGGGGCTTGAGGTTTACAACTGGTATGACTGA
ggtatcctgcggtggctggcgtgctgggcatggggcctgctcacagacagcatggagcag
ggatgggctgtctgtgcccatgctcagcatgccttgaggggaggaggtggtggccgtggg
ttcctgatgtcggtgcaggagctgaaggtgagtggagtgctgccaagaatatgcccgact

 2.06 PlyA -   9321   9316    6                               1.05
 2.05 Term -   9515   9396  120  2  0   68   48    61 0.750  -1.12
 2.04 Intr -   9680   9612   69  2  0   56   72   130 0.651   8.07
 2.03 Intr -   9894   9781  114  0  0  101   77    57 0.982   7.05
 2.02 Intr -  10148   9966  183  2  0   89  105   147 0.984  17.00
 2.01 Intr -  10348  10237  112  0  1   89   99    78 0.511   9.88

Predicted peptide sequence(s):


>WDR6_1|GENSCAN_predicted_peptide_1|1219_aa
XWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDSQPEW
ALDRAYRDARLRALLMGSAARWEGSFSREFSSLLSRGCLSTSRIDMDALEDYVWPRATSE
LILLPVTGLECVGDRLLAGEGPDVLVYSLDFGGHLRMIKRVQNLLGHYLIHGFRVRPEPN
GDLDLEAMVAVFGSKGLRVVKISWGQGHFWELWRSGLWNMSDWIWDARWLEGNIALALGH
NSVVLYDPVVGCILQEVPCTDRCTLSSACLIGDAWKELTIVAGAVSNQLLVWYPATALAD
NKPVAPDRRISGHVGIIFSMSYLESKGLLATASEDRSVRIWKVGDLRVPGGRVQNIGHCF
GHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRGIRAIAAHERQAWVIT
GGDDSGIRLWHLVGRGYRGLGVSALCFKSRSRPGTLKAVTLAGSWRLLAVTDTGALYLYD
VEVKCWEQLLEDKHFQSYCLLEAAPGPEGFGLCAMANGEGRVKVVPINTPTAAVDQTLFP
GKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPSGKAIFVKERCRYLLPPSKQRWHT
CSAFLPPGDFLVCGDRRGSVLLFPSRPGLLKDPGVGGKARAGAGAPVVGSGSSGGGNAFT
GLGPVSTLPSLHGKQGVTSVTCHGGYVYTTGRDGAYYQLFVRDGQLQPVLRQKSCRGMNW
LAGLRIVPDGSMVILGFHANEFVVWNPRSHEKLHIVNCGGGHRSWAFSDTEAAMAFAYLK
DGDVMLYRALGGCTRPHVILREGLHGREITCVKRVGTITLGPEYGVPSFMQPDDLEPGSE
GPDLTDIVITCSEDTTVCVLALPTTTGSAHALTAVCNHISSVRAVAVWGIGTPGGPQDPQ
PGLTAHVVSAGGRAEMHCFSIMVTPDPSTPSRLACHVMHLSSHRLDEYWDRQRNRHRMVK
VDPETRYMSLAVCELDQPGLGPLVAAACSDGADSGRILQLLAETFHHKRCVLKVHSFTHE
APNQRRRLLLCSAATDGSLAFWDLTTMLDHDSTVLEPPVDPGLPYRLGTPSLTLQAHSCG
INSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLEEAVGEAGLVPQLRVLEEYSVPC
AHAAHVTGLKILSPSIMVSASIDQRLTFWRLGHGEPTFMNSTVFHVPDVADMDCWPVSPE
FGHRCALGGQGLEVYNWYD

>WDR6_1|GENSCAN_predicted_peptide_2|199_aa
XLTDQPYTPSDPAWTEIFGVLSVATIKFEMLSTAPQSQLFLALADSSISTKGTKSGTFVM
YNCARLATLFESYKCSMEQGLYPTFPPVSSLDFSLLHDEGEWLLLFNSILPFPDLLSRTA
VLDCTAPGLHIAVRTEMICKFLVQLSMDFSSYYNRVHILGEPRPHLFGQMFVRLQLLRAV
REVLHTGLAMLGLPPLSHI