GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:02:20

Sequence UQCRC1_1 : 13434 bp : 53.21% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1233   1421  189  2  0   76   43   129 0.529   7.50
ccagctactcgggaggctgaggcaggagaatcgcttgaagccgggaggcggaggttgcag
tgagccgagatcgcgccattgcactccagcctgggcgacagagcgagaccctgtctcaga
aaataaaaaataaataaagagaaaaaaatactgactttcagcaccaacttgtggtcccag
GTAAGTTTCCACGCTGGTACTTTAGCCCTGGGCTCGAACCTGCGGACACGCTGTGGCTGC
AACTCCCCGCCCGCCAGACCTCAGTACGCAGCGCGGCTGGTGAGAAACATAATGCACTCT
GACTTCCACGCGTGGAATGGGGAGATGGACTGCACGGCGGGCGGACCTGCTCGGGCTGAT
GGACGGCAG
gtggactgatgtgcgcagggactggcggcagcgcggtcagagccagtcagccaaagccag
gccagcacaatagactgtcccggttcccgccaggaggcggccgagcaccaactgtacggt
actgcgcctgcgccgcgaccgccaacgcgcccagtctacgcttgcgcggcgcaacagggc

 1.02 Intr +   1515   1691  177  2  0   49   26   133 0.417   3.83
agaaacataatgcactctgacttccacgcgtggaatggggagatggactgcacggcgggc
ggacctgctcgggctgatggacggcaggtggactgatgtgcgcagggactggcggcagcg
cggtcagagccagtcagccaaagccaggccagcacaatagactgtcccggttcccgccag
GAGGCGGCCGAGCACCAACTGTACGGTACTGCGCCTGCGCCGCGACCGCCAACGCGCCCA
GTCTACGCTTGCGCGGCGCAACAGGGCCGACTGCAGCTGGAAGATGGCGGCGTCCGTGGT
CTGTCGGGCCGCTACCGCCGGGGCACAAGTGCTATTGCGCGCCCGCCGCTCGGTGAG
gtggtggcgagagcgcggggcttcgggacagggcttcgggaagcggacaggtgtgggctg
ttagcagtggcaggtcgaggtggggaggacgcggggtcagggccgtgggaaggtcacggc
ggagggcggggaaaggtatctcgccgcttgcctaggggcggggttcgggggtcctcctga

 1.03 Intr +   1936   2076  141  0  0  101  113   201 0.934  24.96
cagtggcaggtcgaggtggggaggacgcggggtcagggccgtgggaaggtcacggcggag
ggcggggaaaggtatctcgccgcttgcctaggggcggggttcgggggtcctcctgaggac
ctgggaggtggggagcgatcccctgaccgagtcctcactcgcggctgttcccttccacag
CCGGCCCTGCTGCGGACGCCAGCCTTGCGGAGTACGGCAACCTTCGCTCAGGCGCTCCAG
TTCGTGCCGGAGACGCAGGTTAGCCTGCTGGACAACGGCCTGCGTGTGGCCTCCGAGCAG
TCCTCTCAGCCCACTTGCACG
gtgagttggggacgcttttggggagagggcctccaggttgggcctgccgtcttttccctg
gttggggtgtgaccttgggctcgagtcttcccgtttgtggtttgggttcggacccaggac
cactcaccccgagaatggccccattccctaccctagccacgccttggcttcacgggacaa

 1.04 Intr +   5382   5468   87  2  0   73  100    80 0.997   8.36
gcccctgttttccaagcatgactgtgtccccaagcacaggggtcctgctggggcagctct
ccctgactccaggattcataagtccctgcctggggcttgtactgagtcactcaggtgggg
tgtgagtagggggctggggagtggtttgtttgtaaccttttctggtggcttcttgaccag
GTGGGAGTGTGGATTGATGTTGGCAGCCGTTTTGAGACTGAGAAGAATAATGGGGCAGGC
TACTTTTTGGAGCATCTGGCTTTCAAG
gtgaggctcttaaagtctgtctcctctgggcttagggctgcctgttgtccctcctgagga
tgaaggtcagaaaaattagcctgattatgggcctcagttgcggggctgatgtctggctgg
ctttcctaaaaggagccacatgagcttaacctctcctgagtgggcacgtatctgatgagc

 1.05 Intr +   6458   6587  130  1  1   75   87   190 0.890  18.37
tttggtcacctcaaggcctgcttagtgcttggtaaacagactctgggatctgtgtcccca
gagtctatgctgagggaggtacctgtggaccagtggtcctgctgggtgtttagcctctga
ggacagggttcttgggttcctgtgtagctcctgattgttctggttgatatctggttccag
GGAACAAAGAATCGGCCTGGCAGTGCCCTGGAGAAGGAGGTGGAGAGCATGGGGGCCCAT
CTTAATGCCTACAGCACCCGGGAGCACACAGCTTACTACATCAAGGCGCTGTCCAAGGAT
CTGCCGAAAG
gtaacacctggaggaagaggcggggacagagggcagggaagcagaggacagctacctagg
agcccctggctgaccacagaatcatattacccttagcgtatggctttgcagctgggcaac
taggggtgggcagcaggagatgccaggcctggggattttgtgctgtcgttggtctgcagt

 1.06 Intr +   6807   7005  199  1  1   67   94   207 0.993  18.13
agcagaggacagctacctaggagcccctggctgaccacagaatcatattacccttagcgt
atggctttgcagctgggcaactaggggtgggcagcaggagatgccaggcctggggatttt
gtgctgtcgttggtctgcagtggtccacctggcacctaaacatgtcctccttgcatctag
CTGTGGAGCTCCTGGGTGACATTGTGCAGAACTGTAGTCTGGAAGACTCACAGATTGAGA
AGGAACGTGATGTGATCCTGCGGGAGATGCAGGAGAATGATGCATCTATGCGAGATGTGG
TCTTTAACTACCTGCATGCCACAGCATTCCAGGGCACACCTCTAGCCCAGGCTGTGGAGG
GGCCCAGTGAGAATGTCAG
gtgagagttggctggccttgtggggggatgcttgctccattctggcctggccagaccctt
tccaggtcacatttttagttggctagctgtcggggttattttcctgagttatgcaactgg
agacagtttctgtatccatgtggtccagtgagtcttttttaatggctttgtgggcttcac

 1.07 Intr +   7595   7674   80  2  2   70  105    93 0.999   8.89
ctctgggccctggaggggtgggtggcagagacaggggaagggggttggggagtgtgctag
ggcccactcttcggagaaaccatgcctctcctagtctgcctcctcagtcccattcatgca
tgtaccccaactcactccagtgtggtagaggtgttgacacactgaccatatgtcttgtag
GAAGCTGTCTCGTGCAGACTTGACCGAGTACCTCAGCACACATTACAAGGCCCCTCGAAT
GGTGCTGGCAGCAGCTGGAG
gtgagtgatggaatcactgaagtcctgggtagtggggtcccagccttggttatcaaagcc
gaggtcctggttcccaccataggggacctttcaccccaggggactctgctcccaccctaa
ccttgaggggaatgaccttcctcctgtgctctctgaggtgggataggattctaccctgcc

 1.08 Intr +   9771   9886  116  1  2   70   69   114 0.615   8.37
cctgtccacaaggcagggtctgtctgaggaggaccttctttcctcaccctgttctaatgt
cacatactcctggtttctcccactaagacaggacatgggggtcctctgcctgtctgtgaa
tcgccccaccctgtgccttgggccctggctggtcagtaatgccactgtctgtctcagcag
GAGTGGAGCACCAGCAACTGTTAGACCTCGCCCAGAAGCACCTCGGTGGCATCCCATGGA
CATATGCAGAGGACGCTGTGCCCACTCTTACTCCATGCCGCTTCACTGGCAGTGAG
gtatgctgccttttgggcaggagtagtgctcagctgggggcctgtgggaggacccccatg
tgcatggttatcctggtgactccagagatacctcagcagttgggaaggggttctgtggct
gctgcatcacaggcacacatgttcacacacatacaccctctacccacacctgccaccttt

 1.09 Intr +  10120  10263  144  0  0   80   89   214 0.900  21.69
ccccatgtgcatggttatcctggtgactccagagatacctcagcagttgggaaggggttc
tgtggctgctgcatcacaggcacacatgttcacacacatacaccctctacccacacctgc
caccttttctgttcccctggcagtctggctgttcctcagccttgtcatgtactgtttcag
ATCCGCCACCGTGATGATGCTCTACCTTTTGCCCACGTGGCCATTGCAGTAGAGGGTCCT
GGCTGGGCCAGCCCGGACAATGTGGCCTTGCAAGTGGCCAATGCCATCATCGGCCACTAT
GACTGCACTTATGGTGGTGGCGTG
gtgagtgccagcgcgagcatgggacctcgccttcagggaagagagggtgctggggctgtg
tgctcctgtgcgtgggggtcacagtgtgcgttgaagacaagagggtgggtgctgaccacc
tatccccctggcagcacctgtccagcccactggcttcaggtgctgtggccaacaagctat

 1.10 Intr +  10398  10558  161  2  2   49  103   166 0.964  13.50
caatgccatcatcggccactatgactgcacttatggtggtggcgtggtgagtgccagcgc
gagcatgggacctcgccttcagggaagagagggtgctggggctgtgtgctcctgtgcgtg
ggggtcacagtgtgcgttgaagacaagagggtgggtgctgaccacctatccccctggcag
CACCTGTCCAGCCCACTGGCTTCAGGTGCTGTGGCCAACAAGCTATGCCAGAGTTTCCAG
ACCTTCAGCATCTGCTATGCAGAGACGGGCTTGCTGGGTGCACACTTTGTCTGTGACCGA
ATGAAAATCGATGACATGATGTTCGTCCTGCAAGGGCAGTG
gtaagtggcagcctggtattcctaggtgggatggcggctttaaccagcacagtgggaggc
tgagagatgacacactggctcagaatgaataccacccacccccccactttaggatgcgcc
tgtgtaccagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccc

 1.11 Intr +  10671  10756   86  0  2   66  101    76 0.812   6.66
ctgggtgcacactttgtctgtgaccgaatgaaaatcgatgacatgatgttcgtcctgcaa
gggcagtggtaagtggcagcctggtattcctaggtgggatggcggctttaaccagcacag
tgggaggctgagagatgacacactggctcagaatgaataccacccacccccccactttag
GATGCGCCTGTGTACCAGTGCCACGGAGAGTGAGGTGGCCCGGGGCAAAAACATCCTCAG
AAATGCCCTGGTATCTCATCTAGATG
gtgagtcctacagctcagcggggaggggtagagtacatcttgccagcgacagcaccaagg
tggccactgctcctaactaaccaaggttagaaaggaaaactttgaagaccacgccatgcc
ccatcaccccacccttggagatgcaggcaggtgtgagacaggtccacagcccatcactgc

 1.12 Intr +  11087  11175   89  0  2   69   34   111 0.993   3.99
gtgtgagacaggtccacagcccatcactgccataataggtgaccatagaagagagggctg
tgatctgagtcagcatgaggtcagggaggtccttgtcaacctgaggctggagattgtttg
tgtacctgtgggtccaggattgggctgggtggacctctgagccttctctcacccttaaag
GCACTACTCCTGTGTGTGAGGACATCGGACGCAGCCTCCTGACCTATGGCCGCCGCATCC
CCCTGGCTGAATGGGAAAGCCGGATTGCG
gtaacatggacccctgggagaggttctggagtcttggcctggcagacacctgggaggtgt
agggttggggcctggcatagcgcagcctgctcctataggcatccctggtgtcctaggcag
ctgtcacctgcaggggtagcatagtgggagggcagggcataggtgctgatggctgtggag

 1.13 Intr +  11528  11603   76  1  1   79  115   128 0.883  14.18
ctgtggagatgggcggggcccatggaggtctatagcagggatcccttctgcctttcctct
tttgggctggggacagctgcatgctgcctgtgggagatctctgctagttggatgatgctg
actggctgaggtggtggccaggtgcccgttagccagtatgccctctgcctcaccctgcag
GAGGTGGATGCCAGTGTGGTACGTGAGATCTGCTCCAAGTACATCTATGACCAGTGCCCA
GCAGTGGCTGGATATG
gtaagtggcctagggggtctgctctttgtttatttcctcaggccgttctcttggcctccc
cttccacctctgctcccgcactgctgctcagcttacagagcagccagttaaggccccaag
cagctctccccagtcccctggctgccagggagttcttgctcagaaaacctgtcccagcag

 1.14 Intr +  11645  11833  189  0  0  103   97    45 0.957   6.98
ctgactggctgaggtggtggccaggtgcccgttagccagtatgccctctgcctcaccctg
caggaggtggatgccagtgtggtacgtgagatctgctccaagtacatctatgaccagtgc
ccagcagtggctggatatggtaagtggcctagggggtctgctctttgtttatttcctcag
GCCGTTCTCTTGGCCTCCCCTTCCACCTCTGCTCCCGCACTGCTGCTCAGCTTACAGAGC
AGCCAGTTAAGGCCCCAAGCAGCTCTCCCCAGTCCCCTGGCTGCCAGGGAGTTCTTGCTC
AGAAAACCTGTCCCAGCAGTTCCTTGACTGCCTGCCAAGGTGCCTTCATCAATACCCTGC
ACCCGTCAG
gtaacgggcacctccatgtggggtggggcttcaagggccagaacatgaagggacaggctc
agcacccctgggggaatgttctctcctctctttccactcaaagcctgtcttgtgctgctc
tgggcagcatctccgagctgggtgcggcacagggccaggtgtccctgtgcaggccaggta

 1.15 Term +  12046  12110   65  2  2  128   48   133 0.994  11.64
aagggccagaacatgaagggacaggctcagcacccctgggggaatgttctctcctctctt
tccactcaaagcctgtcttgtgctgctctgggcagcatctccgagctgggtgcggcacag
ggccaggtgtccctgtgcaggccaggtaccccaccctgacgctccaccctatccccacag
GCCCCATTGAGCAGCTCCCAGACTACAACCGGATCCGTAGCGGCATGTTCTGGCTGCGCT
TCTAG
gcgggaagcctatgtaagcaagagggcagggccggggtttgtggtcccccccccaccaca
aacacagcacttcggctcctctaacctgtgccacaggtgaccaccaataaaatcctctgc
tgagaagtgtgtcatccctcttttggcattggcatggagtccatggggcagtagatgggg

Predicted peptide sequence(s):


>UQCRC1_1|GENSCAN_predicted_peptide_1|642_aa
VSFHAGTLALGSNLRTRCGCNSPPARPQYAARLVRNIMHSDFHAWNGEMDCTAGGPARAD
GRQEAAEHQLYGTAPAPRPPTRPVYACAAQQGRLQLEDGGVRGLSGRYRRGTSAIARPPL
GEPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVASEQSSQPTCTVGVWIDVGSRF
ETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHLNAYSTREHTAYYIKALSKDLP
KAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAV
EGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGGIPWTYAEDA
VPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPDNVALQVANAIIGHYDCTYGGG
VHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVCDRMKIDDMMFVLQGQWMRLCT
SATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDASVV
REICSKYIYDQCPAVAGYGRSLGLPFHLCSRTAAQLTEQPVKAPSSSPQSPGCQGVLAQK
TCPSSSLTACQGAFINTLHPSGPIEQLPDYNRIRSGMFWLRF