GENSCAN 1.0	Date run: 16-Jan-104	Time: 07:53:07

Sequence TDGF1_1 : 7137 bp : 44.04% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   2573   2625   53  2  2  101   97     9 0.530   1.65
actttttttcaacatttttctttgttacatgaattagccattaaaaaaagaaagatggtg
ctctacaatttcttttcagtgatctgtggtcttgtccttgtgatgagaggacctgggtgt
taacttgtaaggttttatttcctttgtttggctaactcatgtctgacttcctcttcctag
TGTGATTTGGATCATGGCCATTTCTAAAGTCTTTGAACTGGGATTAGTTGCCG
gtgagagaccttttgttcttttgatcactctcaatttttatgtggcctaaaatacagact
ccatgaattgattttgtcgttaagggctgggccatcaggaatttgctcgtccatctcggg
gatacctggccttcagagatgacagcatttggccccaggaggagcctgcaattcggcctc

 1.02 Intr +   2710   2844  135  2  0   42   61    73 0.584   0.54
tttcctttgtttggctaactcatgtctgacttcctcttcctagtgtgatttggatcatgg
ccatttctaaagtctttgaactgggattagttgccggtgagagaccttttgttcttttga
tcactctcaatttttatgtggcctaaaatacagactccatgaattgattttgtcgttaag
GGCTGGGCCATCAGGAATTTGCTCGTCCATCTCGGGGATACCTGGCCTTCAGAGATGACA
GCATTTGGCCCCAGGAGGAGCCTGCAATTCGGCCTCGGTCTTCCCAGCGTGTGCCGCCCA
TGGGGATACAGCACA
gtaagaactgcctgacttcgatgcttctgccctggcccttcatgtgtctcctgagtatct
ttccaacactctttcacctaaaagggcacctggttctggaactgtgcaggtgctggactg
cttttggttttggaagtgagacaaggattgtgtattttacttccctagagtgcagttttc

 1.03 Intr +   3217   3331  115  2  1  130   63    96 0.573  10.81
cacttcacactggggaacccagaaccaccactggcctatgcatgaaaatgacttctctgc
tcaaaggcacagagacttactctgatacaacacattggtgttgtattaaccttcgcttac
aggaattgcccttgcacttttccatccctacaccctcagtcatctgttcttacctttcag
GTAAGGAGCTAAACAGAACCTGCTGCCTGAATGGGGGAACCTGCATGCTGGGGTCCTTTT
GTGCCTGCCCTCCCTCCTTCTACGGACGGAACTGTGAGCACGATGTGCGCAAAGA
gtaagcaattcagaggggcggggagccgtggagaggagagagaaagggaagtggaaattt
cagacccaaggctatcgccttacctgttcattctcaggaactgtgggtctgtgccccatg
acacctggctgcccaagaagtgttccctgtgtaaatgctggcacggtcagctccgctgct

 1.04 Intr +   3429   3538  110  0  2   93   91     3 0.438   1.03
gggggaacctgcatgctggggtccttttgtgcctgccctccctccttctacggacggaac
tgtgagcacgatgtgcgcaaagagtaagcaattcagaggggcggggagccgtggagagga
gagagaaagggaagtggaaatttcagacccaaggctatcgccttacctgttcattctcag
GAACTGTGGGTCTGTGCCCCATGACACCTGGCTGCCCAAGAAGTGTTCCCTGTGTAAATG
CTGGCACGGTCAGCTCCGCTGCTTTCCTCAGGCATTTCTACCCGGCTGTG
gtaagcggaggttctcctctttcttttgccctttgaagttacgtagttgccttggggggt
gcttagttagcaggctctccttgtacctcttgtcttgctagagcctggcagccaaagttc
tgcttataaaagcatcgcagactcctgatgagatagttgccttggcctctttgatattta

 1.05 Term +   4610   4728  119  0  2   89   37    38 0.373  -2.50
gaatctaaccaggttgtgctcattcctgcaagtgaaggcatcaccactgggctaggttcc
aggtgtgagtgtcctgagaagagcaggttcacagtagcgtatagatatgccacatttgtg
ggcagcaggatgaactgccagagaggtttgctttaatgaccaagcatccctaccttccag
ATGGCCTTGTGATGGATGAGCACCTCGTGGCTTCCAGGACTCCAGAACTACCACCGTCTG
CACGTACTACCACTTTTATGCTAGTTGGCATCTGCCTTTCTATACAAAGCTACTATTAA
tcgacattgacctatttccagaaatacaattttagatatcatgcaaatttcatgaccagt
aaaggctgctgctacaatgtcctaactgaaagatgatcatttgtagttgccttaaaataa
tgaatacatttccaaaatggtctctaacatttccttacagaactacttcttacttctttg

Predicted peptide sequence(s):


>TDGF1_1|GENSCAN_predicted_peptide_1|177_aa
XVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMG
IQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLC
KCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY