GENSCAN 1.0	Date run: 16-Jan-104	Time: 06:29:00

Sequence SLC2A2_1 : 33031 bp : 37.13% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   6062   6168  107  0  2  -20   85   125 0.272   0.41
tttttcagatgtgcttcgcttttgaatgtctgtatctgactaatgagggatgcaaaataa
ccaagaagttaaaagcgtaagatctggaaccaagtcattgttctttaatttactaactgt
gagatgttaaactaatctagttatctataaaatggggacattaatggtgctgccatgaag
AATGTGGTAGACAGAATAATCGTCCTCCAAAGAAGTCCACAGCTGCATTGCCAGAACCTG
GGAATATCTTGCCTTATGTGGCAAAAGACTTTACAGATGAGATTAAG
gtaatagacctagagatgagattttcctggattaccctgatgggtcaaatctaatcctat
gaattctcaaaagggaagaactttcccagctacttgtcagtgccagagagatgtaacatg
agaaggacctgacctgcccattactggctataaagaggaaagaaagataccagtagccaa

 1.02 Intr +   9557   9653   97  1  1  117    6   106 0.425   3.96
ggctcacattcttgtatgaacaacacctgccagcctggagcacagggcatactgcaaatc
gatattgaggggaaagaaccagcctgtggagcctgtaagaagtttaagctgcagcctgac
agaaagatgggaaactaaaattgcctggtgtttccctgccctgtgtctcgccccctgcag
GTCACTGGGACCCTGGTTTTCACTGTCATCACTGCTGTGCTGGGTTCCTTCCAGTTTGGA
TATGACATTGGTGTGATCAATGCACCTCAACAGGCAA
gtgaaatatgtagaagttctctttttggcaagttctgtcagtgatagatatcatatgttc
ctcatacacagagataaagggtgtccacgtgggagacacaaggccatcctggcctgtcag
gtacgatgtgcactgttccaaagctgataacttggccttgactccctaattaacaatcac

 1.03 Intr +  10458  10540   83  1  2   79   73    40 0.623   0.04
tttctccacgatgactccttgggtgaatttttaatcaagttatttcaaccatttttctca
tatatttcgtgcatccctattctggtattcagtgaatacatgggagaggtatgttattct
cagctcccacagcccataagtcggggaaccaggacttcattcccctctgctctaactcag
ACTGTGAGGTCATTGAGGGCAAGACTGATGAATTGTTCCTCTTCCTATCACTGGTGCCAA
GCACAGTAGTTGGCATAAAGAAG
gtactcaataaagaggggtgaattaatgaaagacagagaagaggaacctggggaagaggt
ggcataaagtgaaggtacaaacattttttcggtgccttctgtaagtccattatatttcct
ctgcttcttttagaacattgagccccaaggaaaatgaaagatactgcagggtgtggatat

 1.04 Intr +  13449  13683  235  2  1  102   60   178 0.062  12.74
aatttataacctttcttttataggatatggccaactgtaaacaaatctatccatgtttat
atgtatataaaacacataattgagatggtactatttaaacacgtaacaaacactttaaag
acaaaaacaaaaatacatagaatgtttgaaatagtaaagctatttttctttatctcctag
GTAATAATATCTCACTATAGACATGTTTTGGGTGTTCCACTGGATGACCGAAAAGCTATC
AACAACTATGTTATCAACAGTACAGATGAACTGCCCACAATCTCATACTCAATGAACCCA
AAACCAACCCCTTGGGCTGAGGAAGAGACTGTGGCAGCTGCTCAACTAATCACCATGCTC
TGGTCCCTGTCTGTATCCAGCTTTGCAGTTGGTGGAATGACTGCATCATTCTTTG
gtgggtggcttggggacacacttggaaggtaggcaaatttcataaataagcataaacaga
aactttcatattttcattttcctaacacttgtttagaaaaatattatctttcttcttgtg
gaatagctttagagttgttttttcaactcatgaccctatgaggcatatcagtgttagatc

 1.05 Intr +  20917  21032  116  2  2   76   98   127 0.367  11.75
tatgaggtcatatcaaatatctcctgcacaaactatgtctatacctaggaacaagggttc
atccttccagtgaattcagggaggggctttcattcaagatatatactgtacttaaaccaa
attgttattattgagatagtcctggttgcactttaacatttatgtttatgtttcatgcag
GGCTAATTTCAGGCCTGGTTCCTATGTATATCGGTGAAATTGCTCCAACCGCTCTCAGGG
GAGCACTTGGCACTTTTCATCAGCTGGCCATCGTCACGGGCATTCTTATTAGTCAG
gtaaaaactccccatccttatcccctactgcacccatctacttcatcctctacagtacca
ctactactattgcatcccctactgtacttcctccacttcatccatctcgtccctccctga
ctgtccattctcactgtagaccagcacagagagaaaagccaattctaccagtggtagtgg

 1.06 Intr +  22075  22237  163  0  1   99  106    64 0.995   7.93
tataacaaatagttcctaatttagttaaagtgagatacaatagtaacagtttccgttttt
acttgaaccaaagttgtcagagactactattaaatagccaaagtactttttcaacaaact
agtgtaaaaggtagatccaaagtattatgtagttgatatacttcctccttgcattttcag
ATTATTGGTCTTGAATTTATCTTGGGCAATTATGATCTGTGGCACATCCTGCTTGGCCTG
TCTGGTGTGCGAGCCATCCTTCAGTCTCTGCTACTCTTTTTCTGTCCAGAAAGCCCCAGA
TACCTTTACATCAAGTTAGATGAGGAAGTCAAAGCAAAACAAA
gtaagtctgtggatggtttttctttcttcctattgttttggcattatcagctaatgtaaa
acagtgctttccacatgaagttggtgattaaatgtaagaagaatgtgcaaaatcgctttt
atatgactggtgcatgtcatttggcacccataggcattcacttaagccgaaaccagaaat

 1.07 Intr +  22708  22895  188  2  2   84   88   157 0.989  13.79
gttctatttttcttttaaatcaaagagcaggatctaatttaacaaaaaaagaatttccaa
cacccatgctattaagtaatacaatggggcatgcagaaatgtagctctttcattaacata
aaaataaatttctttttgttttggcctgagttgtttcaacctgatcattttcttggacag
GCTTGAAAAGACTCAGAGGATATGATGATGTCACCAAAGATATTAATGAAATGAGAAAAG
AAAGAGAAGAAGCATCGAGTGAGCAGAAAGTCTCTATAATTCAGCTCTTCACCAATTCCA
GCTACCGACAGCCTATTCTAGTGGCACTGATGCTGCATGTGGCTCAGCAATTTTCCGGAA
TCAATGGC
gtaagtttaagaacacccactaactcttaagagcacagtgaattaaaatagggaaggcaa
ggggtacaagtttaaatagctaaaagatattttaaggtattggcatcatgggtcttgcta
taacaaacgtacattgagtaagcattaatttccattttgcttcaaaagttttctaaaatt

 1.08 Intr +  25500  25604  105  2  0   91   84    61 0.959   5.49
ctttaaacactaaaggaagactgagggttctcttccttggaaggagaaaatctgtacgaa
gttctagggtgcatgccgctatagaaacaactaaaaataaacaatctaaaatatttcttg
ctttaaagatatcagtgccagacttcttaagattaaggctaacctgtttttactttgcag
ATTTTTTACTACTCAACCAGCATTTTTCAGACGGCTGGTATCAGCAAACCTGTTTATGCA
ACCATTGGAGTTGGCGCTGTAAACATGGTTTTCACTGCTGTCTCT
gtaagtcaatgccctagataaatactctgcttgttccttagtccagaaattgcaggaggg
gtggggaacttcggctctaaaagcaatcaatgacttattgtacacatgctctaagtgtgt
aaacccaagtgagtcatgagaagagtcctgtttgaataagccaaccactgcattgagatt

 1.09 Intr +  29014  29115  102  0  0   54  119    26 0.749   1.75
gccacctggggctagagtcactccccaccttgatctcactcctgtaaaatggaaggatgg
aattgcctcttatctgttatataaattaaaatgacctctttggcagtaaaaatgatttaa
gtaaacagtcaatattttgtgactcacaaaactgagataatttctttaaaattgtcctag
GTATTCCTTGTGGAGAAGGCAGGGCGACGTTCTCTCTTTCTAATTGGAATGAGTGGGATG
TTTGTTTGTGCCATCTTCATGTCAGTGGGACTTGTGCTGCTG
gtaagtttggtgcctgcactgaggtttttcattaacatatgatggtacctggcacctctg
tggtccaggttaaagtgctttgtattcaaaaatatttgagactgacttacgaaataaagc
cagagcaacagcataaaatcaaaggagatatataaagaaaagatgaactagtttcttggg

 1.10 Intr +  29784  29987  204  2  0  112  103    89 0.998  11.27
aaagagttatgcatgattcagactagaataatttctctcagaatagaataacttatactt
gcttgaacaaaatacattagaaaaagttgtatgccgcctgtgaactcagaggctacttag
ctaaaggaaaaagcagccaaatgatctcagtcccactattgtttttgtttttttcctcag
AATAAGTTCTCTTGGATGAGTTATGTGAGCATGATAGCCATCTTCCTCTTTGTCAGCTTC
TTTGAAATTGGGCCAGGCCCGATCCCCTGGTTCATGGTGGCTGAGTTTTTCAGTCAAGGA
CCACGTCCTGCTGCTTTAGCAATAGCTGCATTCAGCAATTGGACCTGCAATTTCATTGTA
GCTCTGTGTTTCCAGTACATTGCG
gtaagcagcctaatattccacagatttactgaacagaagagagggtcaaaaaactgctaa
ctcaaagtctgtgtttgctttctatccaggacttctgtggaccttatgtgtttttcctct
ttgctggagtgctcctggcctttaccctgttcacattttttaaagttccagaaaccaaag

 1.11 Term +  30077  30277  201  1  0   94   42   131 0.999   5.51
tcaaggaccacgtcctgctgctttagcaatagctgcattcagcaattggacctgcaattt
cattgtagctctgtgtttccagtacattgcggtaagcagcctaatattccacagatttac
tgaacagaagagagggtcaaaaaactgctaactcaaagtctgtgtttgctttctatccag
GACTTCTGTGGACCTTATGTGTTTTTCCTCTTTGCTGGAGTGCTCCTGGCCTTTACCCTG
TTCACATTTTTTAAAGTTCCAGAAACCAAAGGAAAGTCTTTTGAGGAAATTGCTGCAGAA
TTCCAAAAGAAGAGTGGCTCAGCCCACAGGCCAAAAGCTGCTGTAGAAATGAAATTCCTA
GGAGCTACAGAGACTGTGTAA
aaaaaaaaccctgctttttgacatgaacagaaacaataagggaaccgtctgtttttaaat
gatgattccttgagcattttatatccacatctttaagtattgttttatttttatgtgctc
tcatcagaaatgtcatcaaatattaccaaaaaagtatttttttaagttagagaatatatt

Predicted peptide sequence(s):


>SLC2A2_1|GENSCAN_predicted_peptide_1|533_aa
XCGRQNNRPPKKSTAALPEPGNILPYVAKDFTDEIKVTGTLVFTVITAVLGSFQFGYDIG
VINAPQQANCEVIEGKTDELFLFLSLVPSTVVGIKKVIISHYRHVLGVPLDDRKAINNYV
INSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGLISGL
VPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAIL
QSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSI
IQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMV
FTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFF
EIGPGPIPWFMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAG
VLLAFTLFTFFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV