GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:05:25

Sequence QARS_1 : 11205 bp : 53.06% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1206   1322  117  2  0   73   80   175 0.673  14.52
ggccggtttgtccgccctgtgttgtttaaaggggatagacgaccttggagcgccccgccc
cctcccgccaaggaaggaccccattggctctccccggaggcttcactctcattggtcagc
gagtgaatgccgacctgcagactggggcctaagtttcttttagtttccggtgtctctgca
ATGGCGGCTCTAGACTCCCTGTCGCTCTTCACTAGCCTCGGCCTGAGCGAGCAGAAGGCC
CGCGAGACGCTCAAGAACTCGGCTCTGAGCGCGCAGCTGCGCGAGGCCGCTACTCAG
gtgcgagcccctctgcccccggcctggtttgcagaccatgctgcaacgcagcgcggggcg
gggtccagatcccgacctgccccgtttgtcccgccctttcctctcactgagcgcggggct
tctctcttgacccctctgacctcaggctcagcagaccctgggttccaccattgacaaagc

 1.02 Intr +   1468   1615  148  0  1   79   81    70 0.948   5.72
ctctgagcgcgcagctgcgcgaggccgctactcaggtgcgagcccctctgcccccggcct
ggtttgcagaccatgctgcaacgcagcgcggggcggggtccagatcccgacctgccccgt
ttgtcccgccctttcctctcactgagcgcggggcttctctcttgacccctctgacctcag
GCTCAGCAGACCCTGGGTTCCACCATTGACAAAGCTACCGGGATCCTGTTATATGGCTTG
GCCTCCCGACTCAGGGATACCCGGCGTCTCTCCTTCCTTGTAAGCTACATAGCCAGTAAG
AAGATCCACACTGAGCCCCAGCTAAGCG
gtgagacccctacctgtcctgccagttcgcaccaatgcctcccttcagccaagacccctg
tcttccctttttgccaagtcctccagtttctttctagacacctagttctgcacaggcact
gaggcatggaaggggtggcctatggtgagactgacacgggaactgtcagggtctgagggg

 1.03 Intr +   1841   2076  236  0  2  118   68   204 0.827  19.34
cagccaagacccctgtcttccctttttgccaagtcctccagtttctttctagacacctag
ttctgcacaggcactgaggcatggaaggggtggcctatggtgagactgacacgggaactg
tcagggtctgaggggggatccactctcgacacgtgcttctttcttccctgtgttctctag
GGTGGTGGTGCCAGGGCTTAACTTTTCAGGAGGCCAGACTATCCTTGGAGTTTCATGAGA
TTAGGACCCTGTCTGTCCACTTCTTGGAGCAGAGATGCCACAAACTCACGGGCTCTTTCT
TCTCAGCTGCCCTTGAGTATGTGCGGAGTCACCCCTTGGACCCCATCGACACTGTGGACT
TCGAGCGGGAATGTGGCGTGGGTGTCATTGTGACCCCAGAGCAGATTGAGGAGGCT
gtgagtctttccccaggcatcgtctgcctccccagtcctggccatggaaaggagtggctc
agtttccctcctcaggaagacccagagtgagggtgtgggttcccagaatatctctaaagg
tggctttcctgaaccacatggtttggctttctgcaggtggaggctgctattaacaggcac

 1.04 Intr +   2233   2308   76  0  1   91   80    73 0.946   6.38
accccagagcagattgaggaggctgtgagtctttccccaggcatcgtctgcctccccagt
cctggccatggaaaggagtggctcagtttccctcctcaggaagacccagagtgagggtgt
gggttcccagaatatctctaaaggtggctttcctgaaccacatggtttggctttctgcag
GTGGAGGCTGCTATTAACAGGCACCGGCCCCAGCTCCTGGTGGAACGTTACCATTTCAAC
ATGGGGCTGCTGATGG
gtgagcagggcctggaacggggctatattgttctctctggtcatgccttttcttctgggc
acgagtgagaaggaggtgggggaaggaacaggagtgacttaaagtggtctggctgggctc
aggctctggttctggtggtcagccaggacctttccttgggaaagaggtggggggagtact

 1.05 Intr +   2530   2594   65  2  2   79   99    98 0.972   8.93
catgccttttcttctgggcacgagtgagaaggaggtgggggaaggaacaggagtgactta
aagtggtctggctgggctcaggctctggttctggtggtcagccaggacctttccttggga
aagaggtggggggagtactcttttttgcctttctgcagctccttgtgcctatgcttctag
GAGAGGCTCGGGCTGTGCTGAAGTGGGCAGATGGCAAAATGATCAAGAATGAAGTGGACA
TGCAG
gtgagcgtgcttcactaagctgaagctggcaaagactctggcatgaacagagcctggaat
ccactaagggataaaaggcaggaagagggctgggcatggtggctcacgcttctgatccca
gcactttgggaggctgaggcaggaggattacttgagcccaggagttcaagaccagcctga

 1.06 Intr +   3467   3520   54  1  0   88   97    56 0.983   6.16
caagagcaagagcattttaagctagcagacccacatgagaagagatgggatgggctaggt
aggttttttcagtcagtgctggtagataggccaggaagccttgggttggtgggtaggatc
agtcaggggctccttgaaagaggatactcctgcctctgcctgattctggtctctgctcag
GTCCTCCACCTTCTGGGCCCCAAGTTGGAGGCTGATCTGGAGAAGAAGTTCAAG
gtagggatgggcatggccctgagtccctgagggtgaggtgaggtatggtgagacttcagg
ctggggaaggaagtgtctgaccacagggatcccaagaccctatccaagagaaaatttgat
gccattttctgaagcacctggggcttctttcaggtggcaaaagctcggctagaagaaaca

 1.07 Intr +   3674   3734   61  1  1   66   81    88 0.999   4.70
gaggctgatctggagaagaagttcaaggtagggatgggcatggccctgagtccctgaggg
tgaggtgaggtatggtgagacttcaggctggggaaggaagtgtctgaccacagggatccc
aagaccctatccaagagaaaatttgatgccattttctgaagcacctggggcttctttcag
GTGGCAAAAGCTCGGCTAGAAGAAACAGACCGGAGGACGGCAAAGGATGTGGTGGAGAAT
G
gtgagaagcttgagactcctgtcacagcattcagctccctgacttctgaacctcctcaga
agagtccttacaggctcctcaggcccttggcttactcagtaccctgacttctgtctcaag
actgggattcctggtgtttcttttgttccctttgcccagagactggcatgagaggcctca

 1.08 Intr +   4040   4111   72  0  0   98   53    65 0.936   3.87
gattcctggtgtttcttttgttccctttgcccagagactggcatgagaggcctcagatgt
ctggctctagatatcttgtctctggaattgagggaataggggtctactcagttctgttct
ggctgtaggatatggtaaatgtatctagaggacaagttttccttgttttgttccccacag
GCGAGACTGCTGACCAGACCCTGTCTCTGATGGAGCAGCTCCGGGGGGAGGCCCTTAAGT
TCCACAAGCCTG
gttagtgggcatgtcaaaaccctggggagggctggatcttggcagcagctcctatagtca
ggcccctggggtcagaggctttggctgcagcctggtccttaggcttattctggtcctggc
aggtgagaactacaagaccccaggctatgtggtcactccacacaccatgaatctactaaa

 1.09 Intr +   4234   4319   86  2  2   81   89    53 0.999   4.74
cagaccctgtctctgatggagcagctccggggggaggcccttaagttccacaagcctggt
tagtgggcatgtcaaaaccctggggagggctggatcttggcagcagctcctatagtcagg
cccctggggtcagaggctttggctgcagcctggtccttaggcttattctggtcctggcag
GTGAGAACTACAAGACCCCAGGCTATGTGGTCACTCCACACACCATGAATCTACTAAAGC
AGCACCTGGAGATTACTGGTGGGCAG
gtgtgtggggatgtggccatgtgagcttgtgccatcaaacacctgcctgagtgcctgggc
tgcgtccatactgccccatctcacccatcaccatggccttcctgggagggaacatctgtt
tctttaaggtcatctgagctcagactttatttctcttttcccatcccccttattttaggt

 1.10 Intr +   4498   4584   87  0  0   96  121   139 0.999  18.66
aggtgtgtggggatgtggccatgtgagcttgtgccatcaaacacctgcctgagtgcctgg
gctgcgtccatactgccccatctcacccatcaccatggccttcctgggagggaacatctg
tttctttaaggtcatctgagctcagactttatttctcttttcccatcccccttattttag
GTACGTACCCGGTTCCCGCCAGAACCCAATGGAATCCTGCATATTGGACATGCCAAAGCC
ATCAATTTCAACTTTGGCTATGCCAAG
gtaagcatgtgtctagggacctggcaagcaagatgaccacttgctgttcccatgagtgga
taccatatccctgccttgctgtctgctcccaataatgtacccaggtgggcagaggccatg
gaaaggaaccacatgtgtgacagatacctaggaatctattgagcttattggaataaatag

 1.11 Intr +   5265   5364  100  2  1   31   52   125 0.999   3.38
aggagaaacccaggaggtggaggctgcagtgagccaagatggtgcaagataatcaagact
ccatctcaaaaaaaaagaaaattctgacatgagagtgctctgtgaatatcctagtttgat
aaacaggattgtggggctgatggatgatgtgggagttcacagatggtgcaactttcctag
GCCAACAATGGCATCTGTTTTCTGCGTTTTGATGACACCAACCCTGAGAAGGAGGAAGCA
AAGTTCTTCACGGCCATCTGTGACATGGTAGCCTGGCTAG
gtatggactaggcaaagcctagaagggctggtggttagtgggcctctccttgggccatgg
cctgcccactgggtgtttgtggctggctgctcatactttgtttcattttgccccaggcta
cacaccttacaaagtcacatatgcgtctgactattttgaccagctatatgcgtgggctgt

 1.12 Intr +   5481   5559   79  1  1   89  110    92 0.999  10.60
accaaccctgagaaggaggaagcaaagttcttcacggccatctgtgacatggtagcctgg
ctaggtatggactaggcaaagcctagaagggctggtggttagtgggcctctccttgggcc
atggcctgcccactgggtgtttgtggctggctgctcatactttgtttcattttgccccag
GCTACACACCTTACAAAGTCACATATGCGTCTGACTATTTTGACCAGCTATATGCGTGGG
CTGTGGAGCTCATCCGCAG
gtaaggccagggccatgacgtagagccaggcagactgactaggtcacagccatgctgggc
actcacaccgcttccccacaggggtctggcttatgtgtgccaccagcgaggagaggagct
caaaggccataatactctgccttcaccctggagagaccgtcccatggaggagtcactgct

 1.13 Intr +   5641   5749  109  1  1   91   59    42 0.999   2.39
tttgtttcattttgccccaggctacacaccttacaaagtcacatatgcgtctgactattt
tgaccagctatatgcgtgggctgtggagctcatccgcaggtaaggccagggccatgacgt
agagccaggcagactgactaggtcacagccatgctgggcactcacaccgcttccccacag
GGGTCTGGCTTATGTGTGCCACCAGCGAGGAGAGGAGCTCAAAGGCCATAATACTCTGCC
TTCACCCTGGAGAGACCGTCCCATGGAGGAGTCACTGCTGCTCTTTGAG
gtggggtcctagaggagcatctgggtttgggtgggccaaggtgctgagaatgagatgctc
ctgtgcttagagacagcctgagtccttgttcccctcaggcaatgcgcaagggcaagtttt
cagagggcgaggccacactacggatgaagctggtgatggaggatggcaagatggaccctg

 1.14 Intr +   5848   5978  131  0  2   80   64   184 0.993  15.20
aggagaggagctcaaaggccataatactctgccttcaccctggagagaccgtcccatgga
ggagtcactgctgctctttgaggtggggtcctagaggagcatctgggtttgggtgggcca
aggtgctgagaatgagatgctcctgtgcttagagacagcctgagtccttgttcccctcag
GCAATGCGCAAGGGCAAGTTTTCAGAGGGCGAGGCCACACTACGGATGAAGCTGGTGATG
GAGGATGGCAAGATGGACCCTGTAGCCTATCGAGTCAAGTATACACCACACCACCGCACA
GGGGACAAATG
gtgggtgtagaatggggtggggtggtggggctgccgagcagggcgatgggccatggggta
gggcagagtagggctggatggtagggcccactgcctatgccccacaggtgcatctatccc
acctacgactacacacactgcctctgtgactccatcgagcacatcactcactcactctgc

 1.15 Intr +   6086   6178   93  2  0   79   93   110 0.999  10.18
tggaggatggcaagatggaccctgtagcctatcgagtcaagtatacaccacaccaccgca
caggggacaaatggtgggtgtagaatggggtggggtggtggggctgccgagcagggcgat
gggccatggggtagggcagagtagggctggatggtagggcccactgcctatgccccacag
GTGCATCTATCCCACCTACGACTACACACACTGCCTCTGTGACTCCATCGAGCACATCAC
TCACTCACTCTGCACCAAGGAATTCCAGGCCCG
gtgagggagctgggtccatggggtggtagggccagtggaattccagcagcccttcctgtg
gtctctgcctggttccagagctggccagtgctaaccctactctcccaccccagacgctct
tcctacttctggctttgcaatgcactggacgtctattgccctgtgcagtgggagtatggc

 1.16 Intr +   6292   6429  138  1  0   87   78   129 0.999  11.89
cacactgcctctgtgactccatcgagcacatcactcactcactctgcaccaaggaattcc
aggcccggtgagggagctgggtccatggggtggtagggccagtggaattccagcagccct
tcctgtggtctctgcctggttccagagctggccagtgctaaccctactctcccaccccag
ACGCTCTTCCTACTTCTGGCTTTGCAATGCACTGGACGTCTATTGCCCTGTGCAGTGGGA
GTATGGCCGCCTCAACCTGCACTATGCTGTTGTCTCTAAGAGGAAGATCCTCCAGCTTGT
AGCAACTGGTGCTGTGCG
gtaggtgcggctgtttggcttatgaaaggttaatggcatatgctcccaaaggccttctca
ccaccttcttatccacagggactgggatgacccacggctctttacactcacggccctgcg
acggcggggcttcccacctgaggccatcaacaacttctgtgcccgggtatagcccagcag

 1.17 Intr +   6508   6595   88  1  1   92   47   105 0.992   7.27
cgtctattgccctgtgcagtgggagtatggccgcctcaacctgcactatgctgttgtctc
taagaggaagatcctccagcttgtagcaactggtgctgtgcggtaggtgcggctgtttgg
cttatgaaaggttaatggcatatgctcccaaaggccttctcaccaccttcttatccacag
GGACTGGGATGACCCACGGCTCTTTACACTCACGGCCCTGCGACGGCGGGGCTTCCCACC
TGAGGCCATCAACAACTTCTGTGCCCGG
gtatagcccagcaggttgggtagatacattgggggttgagtgtggcagtttgtgattgta
gctgtgactgatgctgaactttcctgccaggtgggagtgactgtggcacaaaccacaatg
gagccacatcttctagaagcctgtgtgcgtgatgtgctgaatgacacagccccacgagcc

 1.18 Intr +   6686   6829  144  1  0   71   86   120 0.962  11.09
agggactgggatgacccacggctctttacactcacggccctgcgacggcggggcttccca
cctgaggccatcaacaacttctgtgcccgggtatagcccagcaggttgggtagatacatt
gggggttgagtgtggcagtttgtgattgtagctgtgactgatgctgaactttcctgccag
GTGGGAGTGACTGTGGCACAAACCACAATGGAGCCACATCTTCTAGAAGCCTGTGTGCGT
GATGTGCTGAATGACACAGCCCCACGAGCCATGGCTGTGCTGGAGTCACTACGGGTCATC
ATCACCAACTTTCCTGCTGCCAAG
gtgggcctgcctcaacatgtgtgtcacatgtgtgtgtgtagctgggggtacacttggctc
tgggcatgggggtcctaatgctgagtatgactcatacctgtctcctgtctcctgctatag
tccttggacatccaggtgcccaacttcccagctgatgagaccaaaggcttccatcaggtt

 1.19 Intr +   6950   7054  105  1  0   91   84   133 0.975  14.11
cgagccatggctgtgctggagtcactacgggtcatcatcaccaactttcctgctgccaag
gtgggcctgcctcaacatgtgtgtcacatgtgtgtgtgtagctgggggtacacttggctc
tgggcatgggggtcctaatgctgagtatgactcatacctgtctcctgtctcctgctatag
TCCTTGGACATCCAGGTGCCCAACTTCCCAGCTGATGAGACCAAAGGCTTCCATCAGGTT
CCCTTTGCACCCATTGTCTTCATTGAGAGGACTGACTTCAAGGAG
gtaaattgtgggggtggagggtcccgtttgctgctgagtctggtactgggaacctttcat
ctcctcatctctgtcagtccatctacttcctgcttcagatgaaccaatctttgccagaca
cgggggtagggaagcttccccacttgtttgacccttgcagcctcatgtgtctaccccact

 1.20 Intr +   7247   7339   93  1  0  103  100   102 0.999  13.56
ggtggagggtcccgtttgctgctgagtctggtactgggaacctttcatctcctcatctct
gtcagtccatctacttcctgcttcagatgaaccaatctttgccagacacgggggtaggga
agcttccccacttgtttgacccttgcagcctcatgtgtctaccccacttcctatctctag
GAGCCAGAGCCAGGATTTAAGCGCCTGGCTTGGGGCCAGCCTGTGGGCCTGAGGCATACA
GGCTACGTCATTGAGCTGCAGCATGTTGTCAAG
gtgagagccagctgcagccttcctactgcagtgcctgctggggccaagatgtgagtatag
cctgcagtcctggttgtggttcccgggtctaattgctgctcccctccccccacttccagg
gccccagtggttgtgtagagagtctggaggtgacctgcagacgggcagatgctggagaga

 1.21 Intr +   7459   7586  128  0  2  115   74    81 0.999   9.38
gggccagcctgtgggcctgaggcatacaggctacgtcattgagctgcagcatgttgtcaa
ggtgagagccagctgcagccttcctactgcagtgcctgctggggccaagatgtgagtata
gcctgcagtcctggttgtggttcccgggtctaattgctgctcccctccccccacttccag
GGCCCCAGTGGTTGTGTAGAGAGTCTGGAGGTGACCTGCAGACGGGCAGATGCTGGAGAG
AAGCCAAAGGCCTTTATTCACTGGGTGTCACAGCCTTTGATGTGTGAGGTTCGCCTCTAT
GAGCGACT
gtgagtgaacagagctggggtgggggcaggtacaagatgcacattgcctgctatggctgc
ccagctgggggtatgaccttcactttggctgcagattccagcacaagaaccctgaagatc
ctactgaggtgcctggtggatttttaagtgacctgaacctggtaggttcatgaggtttgg

 1.22 Intr +   7681   7747   67  1  1   63   82    75 0.930   3.80
cgggcagatgctggagagaagccaaaggcctttattcactgggtgtcacagcctttgatg
tgtgaggttcgcctctatgagcgactgtgagtgaacagagctggggtgggggcaggtaca
agatgcacattgcctgctatggctgcccagctgggggtatgaccttcactttggctgcag
ATTCCAGCACAAGAACCCTGAAGATCCTACTGAGGTGCCTGGTGGATTTTTAAGTGACCT
GAACCTG
gtaggttcatgaggtttggggtgagggaggtaggcctccctggttggatggttgcctgag
ttccctgcctgcaggcatcactacacgtggtggatgcagcattagtggactgctctgtgg
ccctggcaaaacccttcgacaagttccagtttgagcgtcttggatatttctccgtggatc

 1.23 Intr +   7822   7947  126  0  0   67   44   214 0.954  16.28
gctgcccagctgggggtatgaccttcactttggctgcagattccagcacaagaaccctga
agatcctactgaggtgcctggtggatttttaagtgacctgaacctggtaggttcatgagg
tttggggtgagggaggtaggcctccctggttggatggttgcctgagttccctgcctgcag
GCATCACTACACGTGGTGGATGCAGCATTAGTGGACTGCTCTGTGGCCCTGGCAAAACCC
TTCGACAAGTTCCAGTTTGAGCGTCTTGGATATTTCTCCGTGGATCCAGACAGCCATCAG
GGAAAG
gtgcttgactttactcacctgccctcatctgcagcagtgacagtggctgccgttcattgt
gccaagtgctctgcatacattcccttagttaatcctcaccacctgagggagttggtattc
atattctactagtgaggaaactggcactgaggataactccaggcacaaaattttgtatga

 1.24 Term +   9860   9910   51  1  0   90   49    43 0.664  -1.68
cccattcagtcccttacccaaagtcacaaagttattgaggacccgggcctcctgaccctt
agtccctcggcttctttggcttaagaaggatgttagggggaggtgtctgtggtgaaacct
gcccaggcctccctggccttgttctgggttggtggtcatccttttccctctgccctccag
CTTGTCTTTAACCGAACTGTCACACTGAAGGAAGACCCAGGAAAGGTGTGA
gctggaagcactgaacctacctcatcctcctggagggtgtggctaccctcgccaccccaa
attccatgtcaataaagaacagctaaattctcctagagtctgtgtgttatctctgcactt
ctagcatctgaaggccctgaagacatgctggtggtggtggtatgattgggggatggagat

Predicted peptide sequence(s):


>QARS_1|GENSCAN_predicted_peptide_1|817_aa
MAALDSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLA
SRLRDTRRLSFLVSYIASKKIHTEPQLSGWWCQGLTFQEARLSLEFHEIRTLSVHFLEQR
CHKLTGSFFSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLL
VERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADLEKKFKVAKARLEE
TDRRTAKDVVENGETADQTLSLMEQLRGEALKFHKPGENYKTPGYVVTPHTMNLLKQHLE
ITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFLRFDDTNPEKEEAKFFTAI
CDMVAWLGYTPYKVTYASDYFDQLYAWAVELIRRGLAYVCHQRGEELKGHNTLPSPWRDR
PMEESLLLFEAMRKGKFSEGEATLRMKLVMEDGKMDPVAYRVKYTPHHRTGDKWCIYPTY
DYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALDVYCPVQWEYGRLNLHYAVVSKRK
ILQLVATGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVGVTVAQTTMEPHLLEACVR
DVLNDTAPRAMAVLESLRVIITNFPAAKSLDIQVPNFPADETKGFHQVPFAPIVFIERTD
FKEEPEPGFKRLAWGQPVGLRHTGYVIELQHVVKGPSGCVESLEVTCRRADAGEKPKAFI
HWVSQPLMCEVRLYERLFQHKNPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAKPF
DKFQFERLGYFSVDPDSHQGKLVFNRTVTLKEDPGKV