GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:22:21

Sequence PRKCD_1 : 33737 bp : 56.51% C+G : Isochore 3 (51 - 57 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1338   1430   93  2  0   59  107    31 0.478   2.76
ggcgggggcggggccggcggcacctgggtgaggtcgctcggccccgccccctcgcacttc
cgtgtgccgcggcgccggagcccgaggcggctgtagcccacatctcccgagcgacccccg
gcgcccgcccgccgcgcggaggcccgggccacacctcactggccgcttggcccatcccag
TCAGCGCCGCGCCGAACCCCGTCCGCGCGCGCCGGGGAGCGGCGCCCCCGCCGCTGCCGC
CGCGACCCTTGGCGCCTGCCCCTGCAACGGGAG
gtaagtgagggccgggtccgggcgcgggatcggggctaccccgagggcgcggcgcccttc
cttcccccttcccgccccagttcccgtttccgaaactgagaaactgagccgcggtcagcg
aaagtcccgccgcgccgagacctgccggtgactccgtccccctgtccgtctgtgtgtccc

 1.02 Intr +   5106   5217  112  2  1  134   91    -2 0.326   5.16
cccaggaaaagttgggcccaacaccacatttcaaggaagggaaagccacatccagagaga
cccgaggttttaggtccaggagagactgaactgggcccgtcagccatgctgggactggta
gacggggagagcctgtttggcggtgcctcccggctcagctgtttcctcctgttcctacag
GTCTGCAGGGAACTGGCCAGGCAAGGGGGCAGGCCCGTTTCTCCTGGTGGTTGGTGCGTT
GTAGCAGCAGCGGGAGCCAGGACTAAGGACAAGCAGGAGCTGGGAGCCCCAG
gtaggactgagttctcttaggcagatggatggtgcaccggtgtagccttcctctctggcc
tctttgtcctttgctgtggaactggatggggttgggcatgcatgcagagtccttgatctg
gttgtgggccctgtgtgcccaggggccgcagctgtttgccctgtctatgaggggctctct

 1.03 Intr +   6064   6124   61  2  1   59   65    46 0.093  -2.32
ttgcctccttcagccctattaccatgaaaacattgctgtgggtgactccatactcattcc
aggctggtgactgggtgaccgggccccagtgaacagggtactggtggtgggtatgggtgc
taatgaagctggagcctcggagtaacagtggggggatagcaaagaccgtctttcctccag
GAGTGCTCCCTGAGCAGACCCTCACAGCCAACCCTACTGGCTGTTACGCACCTATAGGTC
T
gtgagtagagccataaaggctgggcttcctgggcctgactctgggttgggggcagaaggg
aggtcagggccttcactctggggtaggagttgggacagaacaggagcagtcttcactggg
ccttctgtgtattggacctgtccctaaacctggtgtggaggaagtaaagcgcctttggct

 1.04 Intr +   8084   8141   58  2  1  101   79    -9 0.051  -1.12
ggagaggagctcctgttggagcagctccacccactcagcagtccagcccctgcctgctct
tctccccctcactccctttcaaagggagaaaatagatctcgtgacaaatggatgcaggga
ggggaaaggcagtctgcagctgcctgctgccccctcagggctccccttggccctctccag
CTCTGGCCTCCTGCAGGACATTAGGCTGGGAGAATTGGCTGGGAACGAGGGGGTGGAC
gtaagccctcctgccagcctgcttacccttcagacccctggagtcagcctgtgggctggg
gcagggagtgggcatctgggactgatggaagctagaagagtagggggagctagaaaaccc
cctacacccatggcagctgggggcagggcccagcctgtcccagggacacgaagaaggtca

 1.05 Intr +  11267  11347   81  1  0   79   50    59 0.101   1.53
cacacgtgtggttattcgtggagaggcccggctgcatcccccaccctggctcctcacaga
ggccccttgtcctcacaggatctggctctctggctcctgccatgaaggggcctttgttcc
tctctcaggggtacctggggcaccgccctctgactgagcccaggactcctcatatcctag
GGCTGGCTGGTGACTCGAGGCCTGTGCCTGGTGGCCTCCCTCCAAGGAGGCCCTACCCCA
CACAAGCTGGCAGAGGTGGAT
gtgagccgatgacagccaggctcccaagtcctgcccctctgaaccttccagaccctctgg
cagggcaggccattatgctcctgctgacccctcagatcgaaggcccccagccaacaggtc
cctgcagcctccgttctcctccagcccccctcactccctgctactcactgcctgcgtggc

 1.06 Intr +  13171  13314  144  0  0   70   51    70 0.063   2.49
cctctgtacaatgaggagatgggcatgtcagtctctgaagacctatctcttgtggagaga
ttgttggggtttttcacctttgacaaaaccattatccaacaagttacatgtgatgcagaa
aaattagcaaatgcattcctgttcctgctggcgctcctcaggccatgtccctcaccccag
CCTCCTGTGCTGGTATACATCAGCACACGTGTGGATGTGCAGCACACATACTTGTCTGCT
GGAGGCAACCAGGACTTCTGTGCCCGGGAGCTCCAAACCCAAGGTCGCTCTGATCACCTT
GAGGCCAGCCTTGCCCACTGCCGG
gtactggctgggaacaggtttccatttgtcccagaggaggtgacctgccttctctggcct
gacctagctactacctttccttacctctgggctgctgatctggggctcacattccctggg
gctgggatccagtgtgtccaagccttccctaggttttgtttttgttttatttgtttttag

 1.07 Intr +  14896  14961   66  0  0   97   43    44 0.137   0.39
aacctggccagagcccatgccctggttttagtcttaggaggttgggtctgacgctatggt
tactgctggttagtctcagggcagcccacgaagaccatggctccccagttctcatggcac
tgcagcctggcagtgcaggtttagggctggggcctgctgtgtttgtggttttccctccag
TGGCTTCTAAATGTGAGCAGCAGCTGCTCTGAGTGTGGCCTGAGAGAGCTGGAGGGCCAC
CCTTGG
gtgggcaggtcctgggctctgcctcaccctcctggggcttctctgacccactgtctcctc
caccctccatgcagtcctggggtggtccccacgcatacctcctgctgggcaggccggggg
taggggaagccatggagcctgtgggctgtcagggctgggccccaagggttggtggctggg

 1.08 Intr +  16321  16367   47  0  2  102   72    11 0.066  -1.40
agggcagctggcctggcacacaggccacctgctggtgtcaggctgaaggcttcgggactt
gggctcaggcatgagcttgcacacccactctcacatccactgagtaggagccagggccgg
gcaaggaatgtggtggggtctgcccctgccctgcctgggtcctgctctctgctttggcag
CTGCTGGCCTCAGAGGGCTGCCTGGACTCACTGGGCTGGGCTGCAGG
gtgaggtcagcatttgctgtgagctcatctgagctgggagctcccagcagagctggccac
tgctctggccaccttgtgcaggagctggaggaagtcatctggggctgggcagctgttgtg
tgtgcatgcacacgtgtgtgtctgagtgtgcccctgtgtgctggcttatgttcaggatgg

 1.09 Intr +  18406  18539  134  1  2   81   96   289 0.114  29.80
cactgcgcctggcaaacctctcagtttttaacactggcaactgagactagtgtgtgtgtg
catcatgtgggccaaacccaatcatagcagagccctgggggagcgggtccctgagtgctg
cccgtgactgttcccgctggtcccgcccggccgcctggcctcacccctctgtgtgcacag
CCCCACTGCAGGCCCCACCATGGCGCCGTTCCTGCGCATCGCCTTCAACTCCTATGAGCT
GGGCTCCCTGCAGGCCGAGGACGAGGCGAACCAGCCCTTCTGTGCCGTGAAGATGAAGGA
GGCGCTCAGCACAG
gtaggcctggaggctggaccctggagaggggctgggaatctgggcccagctggaaggact
ggagggggcctggccttgttccctgcaacctctgaaggattctgctcttcctcatccttg
actccctgccccactcagctatgaaggcagaggccactgagtcgctatagggctgcaaac

 1.10 Intr +  19579  19778  200  2  2  105   82   332 0.999  33.89
tggagggaggacctagcagggtgcccaaggtagttctgtgctctagaggacactggggaa
ccacagcaggccctcaaggcaggagagtcgggcagattctgccaggggaaggccgtggag
gtctacgagggagggacagaggggccatggcccaaccttctctgcctggccttgttgcag
AGCGTGGGAAAACACTGGTGCAGAAGAAGCCGACCATGTATCCTGAGTGGAAGTCGACGT
TCGATGCCCACATCTATGAGGGGCGCGTCATCCAGATTGTGCTAATGCGGGCAGCAGAGG
AGCCAGTGTCTGAGGTGACCGTGGGTGTGTCGGTGCTGGCCGAGCGCTGCAAGAAGAACA
ATGGCAAGGCTGAGTTCTGG
gtaaggggcgcacgagccgtgccgtgtgtgtgtgtgtgtgtgtctgtgtgtgtgtgcatg
cgtgcatgtgtgtgcgtgcacacacgcgggcttggtcagtgagcacagctgaagagcacc
gggccctgtgctggccaccagtccagccctgtggccaacatgtcctgggtgtgaatcctg

 1.11 Intr +  21209  21269   61  1  1   85   86    83 0.988   6.60
tggggctcaggagtggggctcaggcggggccctgcccacactgggcagacaagtgtctgg
ctaggccttggggggctgccttggccttgggggaccagccatgggggtgggttctgagtt
tggcctggcccaggctgccctcactgaccttgttctcccctggcctctggcccccaacag
CTGGACCTGCAGCCTCAGGCCAAGGTGTTGATGTCTGTTCAGTATTTCCTGGAGGACGTG
G
gtaagaactccctgggggtggagggctcccttgccgggttcagaggcagagccagcactg
aggtgtagggaagctgctcccttcggcagagctgtccaggaccaccctgggagggactgt
aggggtgccaccccttccagataccagggctgacttccctactccatggtcaccagattg

 1.12 Intr +  21446  21608  163  0  1   68   85   215 0.957  18.75
gtgggtaagaactccctgggggtggagggctcccttgccgggttcagaggcagagccagc
actgaggtgtagggaagctgctcccttcggcagagctgtccaggaccaccctgggaggga
ctgtaggggtgccaccccttccagataccagggctgacttccctactccatggtcaccag
ATTGCAAACAGTCTATGCGCAGTGAGGACGAGGCCAAGTTCCCAACGATGAACCGCCGCG
GAGCCATCAAACAGGCCAAAATCCACTACATCAAGAACCATGAGTTTATCGCCACCTTCT
TTGGGCAACCCACCTTCTGTTCTGTGTGCAAAGACTTTGTCTG
gtgagaaccggccatgcccactggtggtggtgcagggtagtgggggccgatcccggtccc
cgctcactcactttgcctgggttttgcctttcaggggcctcaacaagcaaggctacaaat
gcaggcgtaagtgtctccacaggccagtttgtacgtatgtacccatgtgtgctcacgtgt

 1.13 Intr +  21703  21734   32  1  2  107   88    46 0.940   4.76
aaaatccactacatcaagaaccatgagtttatcgccaccttctttgggcaacccaccttc
tgttctgtgtgcaaagactttgtctggtgagaaccggccatgcccactggtggtggtgca
gggtagtgggggccgatcccggtccccgctcactcactttgcctgggttttgcctttcag
GGGCCTCAACAAGCAAGGCTACAAATGCAGGC
gtaagtgtctccacaggccagtttgtacgtatgtacccatgtgtgctcacgtgtgccagt
gcctgtgtgtatgccagtgcctgtgtgcgctcagagagtgtatgcacgtgagttttccca
gtgtagatacagcagctgagttcagtgagtgctggggctggcttgctgctgctctggaaa

 1.14 Intr +  22939  22992   54  2  0  107   60    28 0.459   1.34
catgtgtaagagagggcatttaggagccgtttgctatcccagggcttggaagaactgccc
ccgcttctcatattgcgatgccctgtgcccgctaacttctgcccacctccctgcccacta
ggactccttctttctaagcccctgcagattggcctgtcctctccgccccgtcctctccag
GCTCCTCCTTCGAGGGCTGGCAGGAGGAAGACTCAAGCGCTGGGCCTCTGCGGG
gtgagggtgtgggcggtcaggagaacggtggctttgtgtagagggctagactggtcggca
ggcaccagctcatagactctgcccctcccggtgctttcccttccccctcctgggcctgtg
cctcttcaagaatgtaacgctgccatccacaagaaatgcatcgacaagatcatcggcaga

 1.15 Intr +  23123  23208   86  0  2   72   47   162 0.999  10.54
ctccttcgagggctggcaggaggaagactcaagcgctgggcctctgcggggtgagggtgt
gggcggtcaggagaacggtggctttgtgtagagggctagactggtcggcaggcaccagct
catagactctgcccctcccggtgctttcccttccccctcctgggcctgtgcctcttcaag
AATGTAACGCTGCCATCCACAAGAAATGCATCGACAAGATCATCGGCAGATGCACTGGCA
CCGCGGCCAACAGCCGGGACACTATA
gtgagcctgggtccggggcagggctggggatctggggggcttggccagatgggagggatt
tgcaccctctccccaccctccctggggagcttaccctccctccccatttttcttagtctt
tccttgcctctcccagtggagctctcttgggatgttgttgtgcccagggttgggggagag

 1.16 Intr +  23454  23583  130  2  1   62  100   195 0.570  18.87
cctctccccaccctccctggggagcttaccctccctccccatttttcttagtctttcctt
gcctctcccagtggagctctcttgggatgttgttgtgcccagggttgggggagagctagg
ggttgaagaagaggctggagctggcacgtgaccctcagcctgtgatacccccacctccag
TTCCAGAAAGAACGCTTCAACATCGACATGCCGCACCGCTTCAAGGTTCACAACTACATG
AGCCCCACCTTCTGTGACCACTGCGGCAGCCTGCTCTGGGGACTGGTGAAGCAGGGATTA
AAGTGTGAAG
gtgcgtgccaccccgcccctgggctgcaggaggggcactcccagctggtgctgctgtgaa
ttccagccacctcacgccaccctcgcctcctcacctggagacgggcacctcattcaggga
cctgatgagggtgaggccttggtggaccctccccactggcctgactggctctgccactta

 1.17 Intr +  24876  24976  101  1  2  109   80   124 0.998  14.03
gagagagagagagagatcgaagtatttatgatggcttcagatcaatgttttcctagaaac
tggaacccagcagaccccactgaagccctcctttctcttgctctcctgcgcctctcctac
actgccccctgcccttggctgagctctgagactgacagccccgcttctccctcaccccag
ACTGCGGCATGAATGTGCACCATAAATGCCGGGAGAAGGTGGCCAACCTCTGCGGCATCA
ACCAGAAGCTTTTGGCTGAGGCCTTGAACCAAGTCACCCAG
gtgggcaggtgccatggggaccctggacacagggcagtggggtcagggacagtcaaggct
tacagccactgctggggagccacagacagccaggatatatttagacccaggactctactt
cgggaagatgcaactcaagaatttaggcagcagagggaggggggctttttttcataagaa

 1.18 Intr +  25606  25702   97  0  1  102   67    33 0.981   2.68
tctctgggctcctggaagagtgcgtgtgtgtacacgcagcccgagtagggggcctgggct
gtgcccctgttgtctcctcttggtgttaagggtggagttatacctgggagtcttccttct
gggctgggagttctgataatggtctgaccatctggccccccacctctgctccctccccag
AGAGCCTCCCGGAGATCAGACTCAGCCTCCTCAGAGCCTGTTGGGATATATCAGGGTTTC
GAGAAGAAGACCGGAGTTGCTGGGGAGGACATGCAAG
gtgaagctgggtccattgccccattacggtttttattccccctgaggccaaagaaagggg
actgtcctcccttccattgtcaagtgagacatggaaggaaccaccggtcctggggagcga
gccccttcctctctgaggccccttcccccagcctaccccaggccccgggggaggggagtt

 1.19 Intr +  25929  26029  101  1  2   52  100   201 0.987  18.03
gccaaagaaaggggactgtcctcccttccattgtcaagtgagacatggaaggaaccaccg
gtcctggggagcgagccccttcctctctgaggccccttcccccagcctaccccaggcccc
gggggaggggagttgtgtagactgagaccccgatctgaggaggtgccatctctcgggcag
ACAACAGTGGGACCTACGGCAAGATCTGGGAGGGCAGCAGCAAGTGCAACATCAACAACT
TCATCTTCCACAAGGTCCTGGGCAAAGGCAGCTTCGGGAAG
gtgagggctgtgagccgggcacctgcttcccaccccaccctggcttcttcccgcttaggt
ggctgaggtgggagtctgtgaatcgggctgtggcccctgccccgtcctcacctgctcagc
acccgtgtctccccatcaggtgctgcttggagagctgaagggcagaggagagtactttgc

 1.20 Intr +  26169  26342  174  2  0  109   44   306 0.734  28.95
tcatcttccacaaggtcctgggcaaaggcagcttcgggaaggtgagggctgtgagccggg
cacctgcttcccaccccaccctggcttcttcccgcttaggtggctgaggtgggagtctgt
gaatcgggctgtggcccctgccccgtcctcacctgctcagcacccgtgtctccccatcag
GTGCTGCTTGGAGAGCTGAAGGGCAGAGGAGAGTACTTTGCCATCAAGGCCCTCAAGAAG
GATGTGGTCCTGATCGACGACGACGTGGAGTGCACCATGGTTGAGAAGCGGGTGCTGACA
CTTGCCGCAGAGAATCCCTTTCTCACCCACCTCATCTGCACCTTCCAGACCAAG
gtgcccgggcctcctgccgtcaccaccccatgccacagccatgtcccacagctcctcagc
ccccctcagtcagggctgtgtctccccttcaggccacttaaggcagggccatgctttccc
ccctcatgcctcccagggcagagtcgtccacctcagccagggcctgtccctgctgtttcc

 1.21 Intr +  26606  26697   92  1  2  120   75   162 0.471  17.39
ccccttcaggccacttaaggcagggccatgctttcccccctcatgcctcccagggcagag
tcgtccacctcagccagggcctgtccctgctgtttcctgttggggcttggccccagtggc
cctcagtgagggagcctcctgcctattcctcacccctgctcaccacccttcccaccccag
GACCACCTGTTCTTTGTGATGGAGTTCCTCAACGGGGGGGACCTGATGTACCACATCCAG
GACAAAGGCCGCTTTGAACTCTACCGTGCCAC
gtacgtaagggccatggtggggaagggcccagtgtggaggaagggctactggctcagagc
ccacttccagtctgccctccatgccttcttccctctccctagaaaagccagcctgggcta
gagcggcaactggggagatgtgggggtagcctgggtcggcaccacacaggaagccatggg

 1.22 Intr +  28722  28860  139  0  1  119   83   266 0.767  30.17
cttgcaagaagcacctgtttttaggatctctttctccttctgcttccttttctgtttctc
attcccttgtacccttggggacagtcctggactaatacggctgaaaattaggacatgggg
ggcagggttggaaggagaagaaatgtcccctgctgactcttacctgtcccctgtccttag
GGACCTCAAACTGGACAATGTGCTGCTGGACCGGGATGGCCACATCAAGATTGCCGACTT
TGGGATGTGCAAAGAGAACATATTCGGGGAGAGCCGGGCCAGCACCTTCTGCGGCACCCC
TGACTATATCGCCCCTGAG
gtgagccgatacccttccagccccccgctcagtcaggcaccttgcctccccacggtgggc
cagggaaggattcccaagggcagtgatgtccaagccaaagcccataggctgaggcggcct
ggctaggcttcgtgcccaggggcccctctcagcctcagcacctcagctcctgctgacctg

 1.23 Intr +  29060  29248  189  1  0  107   44   341 0.876  31.90
gccccccgctcagtcaggcaccttgcctccccacggtgggccagggaaggattcccaagg
gcagtgatgtccaagccaaagcccataggctgaggcggcctggctaggcttcgtgcccag
gggcccctctcagcctcagcacctcagctcctgctgacctgctgctctccccaccgccag
ATCCTACAGGGCCTGAAGTACACATTCTCTGTGGACTGGTGGTCTTTCGGGGTCCTTCTG
TACGAGATGCTCATTGGCCAGTCCCCCTTCCATGGTGATGATGAGGATGAACTCTTCGAG
TCCATCCGTGTGGACACGCCACATTATCCCCGCTGGATCACCAAGGAGTCCAAGGACATC
CTGGAGAAG
gtggaggccctgggctgggctgggctggtctgggctgggctggggcaggggctggcagac
actgggctttgggtgaggagcttcctgtctctggaatggcagcctcagtggtgctgcagt
cctaacatacggggtattgctctctcaccatgttcccaggaactcctgtctgagtcctgt

 1.24 Intr +  29875  30003  129  0  0   65   68    85 0.979   5.60
catctccgggggagctgggagcactgcaggccagagtggcctccctcagccccaccgttc
cccaggctgactggggctggggcaagcctggctttgcatccctgggcctgctggggattt
gctgaagctccaatttcccatggcccttgggtgctaaccagggtccctgctgggttgcag
CTCTTTGAAAGGGAACCAACCAAGAGGCTGGGAGTGACCGGAAACATCAAAATCCACCCC
TTCTTCAAGACCATAAACTGGACTCTGCTGGAAAAGCGGAGGTTGGAGCCACCTTTCAGG
CCCAAAGTG
gtatgtgatcctgccctgtgctgccttcaggctgagctactcctctcctgccctccctct
ctcctgcatcattcacacgctttccacctctcccttcttccagcaatctccatagcatgt
tcagtcacagccgctgcccttgtattctcatcctctccctcctgactcagtcattcagca

 1.25 Term +  32110  32268  159  0  0   82   51   286 0.994  22.55
cttggggaaatggcagcctccttcccatggggctcctttcaggctgctaggggaggctct
gtcttctgttctgggtgaggacagctctggcctggcccagccctgcagggactccagcct
ggggtgtctggagggccattccctaggtcctgttcgctcacccctgccctctgcttgtag
AAGTCACCCAGAGACTACAGTAACTTTGACCAGGAGTTCCTGAACGAGAAGGCGCGCCTC
TCCTACAGCGACAAGAACCTCATCGACTCCATGGACCAGTCTGCATTCGCTGGCTTCTCC
TTTGTGAACCCCAAATTCGAGCACCTCCTGGAAGATTGA
ggttcctggacagatcaggctagccctgccctccacccacacctgcccgctccccacgat
aagcaccagtgggactgtggtgacttctgctgctggccccgcccctgcccccagagcgtc
cttggctgccgtctggccgggctctcatggtacttcctctgtgaactgtgtgtgaatctg

Predicted peptide sequence(s):


>PRKCD_1|GENSCAN_predicted_peptide_1|900_aa
SAPRRTPSARAGERRPRRCRRDPWRLPLQREVCRELARQGGRPVSPGGWCVVAAAGARTK
DKQELGAPGVLPEQTLTANPTGCYAPIGLSGLLQDIRLGELAGNEGVDGWLVTRGLCLVA
SLQGGPTPHKLAEVDPPVLVYISTRVDVQHTYLSAGGNQDFCARELQTQGRSDHLEASLA
HCRWLLNVSSSCSECGLRELEGHPWLLASEGCLDSLGWAAGPTAGPTMAPFLRIAFNSYE
LGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVL
MRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRS
EDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRRSS
FEGWQEEDSSAGPLRECNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKV
HNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVT
QRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVL
GKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLIC
TFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATDLKLDNVLLDRDGHIKIADFGMCK
ENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDEL
FESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRL
EPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED