GENSCAN 1.0	Date run: 16-Jan-104	Time: 05:51:03

Sequence PLXND1_1 : 54043 bp : 58.33% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Sngl +   1380   2774 1395  2  0   68   49  2842 0.917 272.79
cccgggctgcgcggcgaggctgacccgggcccgggcgccggggtcgggggcggctggcgc
gggcaggaagcgcatcgcggcccgggcccgccccccgcctcccgccgcctccgggctccc
ggctcccggccgcgcctcgccccatgcactcgccgcgccgcgcagcccgcgcacgcccgg
ATGGCTCCTCGCGCCGCGGGCGGCGCACCCCTTAGCGCCCGGGCCGCCGCCGCCAGCCCC
CCGCCGTTCCAGACGCCGCCGCGGTGCCCGGTGCCGCTGCTGTTGCTGCTGCTCCTGGGG
GCGGCGCGGGCCGGCGCCCTGGAGATCCAGCGTCGGTTCCCCTCGCCCACGCCCACCAAC
AACTTCGCCCTGGACGGCGCGGCGGGGACCGTGTACCTGGCGGCCGTCAACCGCCTCTAT
CAGCTGTCGGGCGCCAACCTGAGCCTGGAGGCCGAGGCGGCCGTGGGCCCGGTGCCCGAC
AGCCCGCTGTGTCACGCTCCGCAGCTGCCGCAGGCCTCGTGCGAGCACCCGCGGCGCCTC
ACGGACAACTACAACAAGATCCTGCAGCTGGACCCCGGCCAGGGCCTGGTAGTCGTGTGC
GGGTCCATCTACCAGGGCTTCTGCCAGCTGCGGCGCCGGGGCAACATCTCGGCCGTGGCC
GTGCGCTTCCCGCCCGCCGCGCCGCCCGCCGAGCCCGTCACGGTGTTCCCCAGCATGCTG
AACGTGGCGGCCAACCACCCGAACGCGTCCACCGTGGGGCTAGTTCTGCCTCCCGCCGCG
GGCGCGGGGGGCAGCCGCCTGCTCGTGGGCGCCACGTACACCGGTTACGGCAGCTCCTTC
TTCCCGCGCAACCGCAGCCTGGAGGACCACCGCTTCGAGAACACGCCCGAGATCGCCATC
CGCTCCCTGGACACGCGCGGCGACCTGGCCAAGCTCTTCACCTTCGACCTCAACCCCTCC
GACGACAACATCCTCAAGATCAAGCAGGGCGCCAAGGAGCAGCACAAGCTGGGCTTCGTG
AGCGCCTTCCTGCACCCGTCCGACCCGCCGCCGGGTGCACAGTCCTACGCGTACCTGGCG
CTCAACAGCGAGGCGCGCGCGGGCGACAAGGAGAGCCAGGCGCGGAGCCTGCTGGCGCGC
ATCTGCCTGCCCCACGGCGCCGGCGGCGACGCCAAGAAGCTCACCGAGTCCTACATCCAG
TTGGGCTTGCAGTGCGCGGGCGGCGCGGGCCGCGGCGACCTCTACAGCCGCCTGGTGTCG
GTCTTCCCAGCCCGGGAGCGGCTCTTTGCTGTCTTCGAGCGGCCCCAGGGGTCCCCCGCG
GCCCGCGCTGCTCCGGCCGCACTCTGCGCCTTCCGCTTCGCCGACGTGCGAGCCGCCATC
CGAGCTGCGCGCACCGCCTGCTTCGTGGAACCGGCGCCCGACGTGGTGGCGGTGCTCGAC
AGCGTGGTGCAGGGCACGGGACCGGCCTGTGAGCGCAAGCTCAACATCCAGGTACACCCG
GGCGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGGGGCGGGGGCGGGGGCGGGCGGGAA
CCGAGCGGGTCGTGA
gctgagtgggtcacaggtgggagcgcgcagagatccagatgtacgtggaacccaggtgtg
cacgcgagaatacaggtgtcccccgaggggtactactggcgcctgtatggcccaggtggg
catgtgcagggactcaagtgagtgccggctcatgggcgcgcatacctaggcgtactggga

 2.01 Init +   9968  10086  119  1  2   90   93   102 0.266   8.71
ggggaaggcattccaggcagagcacacgataggggcaaaggctcagagatgttggaatgt
ggcttgggtagcaggccgaggggaagctgagagtgtgctgggccttgcctgcaggctaaa
gacttggatgctgtcatgtgggctgcggggagccagcagggctttggggaaaggagagac
ATGGCTGATCTGGTTCCGGAAGGGACCCTGTGGCTGCTGGTCTGTATTGGCCCTGCCAGG
TGCTGGCAGGATCCAGGGGCGGAGGCGCTCACCCGGAGCCCCCACTGTGGCTGGACCAG
gtaactcccgagggcctctccagctctgacagccatgtggggattgccatggaaaccagc
cggttcccgagtggggacaagcccagaaagtctctgagtgccagccacgtggacttggat
cctcactgccccccaagtacagccgttttcttctttccaaaggccatgtctgagccaggg

 2.02 Intr +  11116  11191   76  1  1   68   -3    71 0.086  -3.33
gaatgagataatacagaaagaggtctcagcacaaagcagactgcacacagctgcttgcta
ctgtcactctaccgaactgttactatgagaaagctgcccctccccatcctggggctgggc
ctctgagctcggatgtgggcagctggagagagggccccgttgtcacctctgtgtccccag
CTCATGGAATCCAGCCCGGAGATGTTTGCGCAAGGCTCCAAGCAGCCCTGTCTTCTTGGC
TGTGTCCACAGCGGTC
gtgcgatgactctgggaccagcggtagagtcctgctgcagagcacagcctgcggccaggc
atatgggctggaccccgaggagaccaggggctggggaggagggtgtgagatcgaacctcc
aagtccccccagccccaggagggaactgccagtgttccctggagaggcaactatttctcg

 2.03 Intr +  14432  14683  252  1  0   59   59   151 0.354   8.17
ctgaatacccgcctccctttgttgccacacgcagagtaggcatacgtttccctcagttct
ccagcacccagcatggccgtgttgctctcagtcactcgacttagagagaaagcagctgac
cacagtcgttcacactttagtcaaaattaggttcctttcttttgtaaacattccctccag
AGCACAGGCTCCATGCTGGAGAACGTCATGCATGTGCTGCCATGGGAAATGTGTGACCAG
CACAGTGCCATCACAGGAGTTGGGGGGCTGAGCCACATCTTGAAAACTTGCCGTCTGGGC
ATGCCTGGAGAGGGAACAGCATGGGTCCAGACACCGGGGGCGCTGAAGTGCCAAGGGGAG
TACGAATGCCTCAGAGGCATGGGATGGGCATTGGCTGCTGAAGGGACATTTACAATGGTA
CAAGAGCCCCGG
gtatgaggtgtgggcacattccaggacctgtggagactgatgtggtgggcgcagcgggtg
gggcagagggaggagggagactggaggcctgggagctggcaggagctggggcacgaaggc
cttgaatgcgaggctggactgctggggcttgatcccgaggacagccaggagctgggttgt

 2.04 Intr +  18492  18668  177  2  0   96  100   331 0.771  36.42
aggcctgggcttggggatggggtcccgtttgtgtttgggcctcagctgagcactgaggat
ataaagtaggaacaagacttgaaagctctgatgccagggcctgagatcccagccagctgt
gcgggcggggagccggagaaggttctggagctgggatctgacgtgccgttcctcttccag
CTCCAGCCAGAGCAGCTGGACTGTGGAGCTGCTCACCTGCAGCACCCGCTGTCCATCCTG
CAGCCCCTGAAGGCCACGCCCGTGTTCCGCGCCCCGGGCCTCACCTCCGTGGCCGTGGCC
AGCGTCAACAACTACACAGCGGTCTTCCTGGGCACGGTCAACGGGAGGCTTCTCAAG
gtaggtatggttggggatgtggggagggggtgggggtgggaggctcccctgggagttggc
tgagggggtcagtctgtacacagggctgctacaggtccagcctgaccctttgttttctcc
cattcgcctagcactttacagtttacaaagtattttgcaagtctgtttttgccactattg

 2.05 Intr +  21300  21431  132  2  0   88   94   164 0.999  19.02
ggcagaagcatcaaggcccggccctgtgccctcccctgcacgcccgtgacttcccacccc
tcctgaagggtccaagacaggatggggaggcagagcccccagacccgggctcaggttgtc
ccctgggtttggcctcccctgctatgggctccagcaccctgatgcccactacccccacag
ATCAACCTGAACGAGAGCATGCAGGTGGTGAGCAGGCGGGTGGTGACTGTGGCCTATGGG
GAGCCCGTGCACCATGTCATGCAGTTTGACCCAGCAGACTCCGGTTACCTTTACCTGATG
ACGTCCCACCAG
gtgaggccagagccccagcccaacgccatcccagcaccagccgagccctcttgcttgcct
ggcctttacacacgctgttcctctgctgggagcaccctcctcctccatctcccttatctg
ctaactccaccttgtcctgcgcctcccaacaccgaccttgcctctgcagggaagccttgt

 2.06 Intr +  21747  21847  101  2  2   76   77    99 0.719   7.67
cctgcgcctcccaacaccgaccttgcctctgcagggaagccttgtctcccatgttccccc
attagagtgttgaccctcagtttccccagcctctcatggcccgcaccatgctgaccgtac
cacctccccaagggagaggctggcagtcccattgagctgggcccccacctctgcccccag
ATGGCCAGGGTGAAGGTCGCCGCCTGCAACGTGCACTCCACCTGTGGGGACTGCGTGGGT
GCGGCGGACGCCTACTGCGGCTGGTGTGCCCTGGAGACGCG
gtgaggctggacaccagcaacagctggaccaggagggctgtgggggtgggaggagctgac
ctgggtcctgaccctgcggtgccaccccaggtgcaccttgcagcaggactgcaccaattc
cagccagcagcatttctggaccagtgccagcgagggccccagccgctgtcctgccatgac

 2.07 Intr +  21938  22067  130  2  1   86   81   208 0.990  21.77
gaaggtcgccgcctgcaacgtgcactccacctgtggggactgcgtgggtgcggcggacgc
ctactgcggctggtgtgccctggagacgcggtgaggctggacaccagcaacagctggacc
aggagggctgtgggggtgggaggagctgacctgggtcctgaccctgcggtgccaccccag
GTGCACCTTGCAGCAGGACTGCACCAATTCCAGCCAGCAGCATTTCTGGACCAGTGCCAG
CGAGGGCCCCAGCCGCTGTCCTGCCATGACCGTCCTGCCTTCCGAGATCGATGTGCGCCA
GGAGTACCCA
gtgagtcctgggggaggcaagacccagctcgggacacaggggagcctcccttcacccagc
acccaggccccgagaggtggagactcccacccatggtgccccaaggacctgaagacaaat
aatgagaacagtgacaatgactgggctttcctgaccaactagtaagtgccaggcacgtgc

 2.08 Intr +  23457  23634  178  2  1   70   98   173 0.984  17.19
aactgaggctcagagggtcacatgtagggcatagccctctggccctgagtcctggccacc
actaccccttcccccaggggacattcaggcagtgccagaccttgggttggtgcacagccc
tggggcaggctgtgaggagcatagcctggacccccagagctgagggctccttgcccccag
GGCATGATCCTGCAGATCTCGGGCAGCCTGCCCAGCCTCAGTGGCATGGAGATGGCCTGT
GACTATGGGAACAACATCCGCACTGTGGCTCGGGTCCCAGGCCCTGCCTTTGGTCACCAG
ATTGCCTACTGCAACCTCCTGCCGAGGGACCAGTTTCCGCCCTTCCCCCCCAACCAGG
gtaagcacgctgtgctgttggcacagccccagaggggcagaacggtggactgtcaggcat
ggggatggcagggggccagaggtcacagcttctgatgttggtggcaatcccctgccccca
tgtcctcccctggctcccccatccattccagaccacgtgactgttgagatgtctgtgagg

 2.09 Intr +  23786  23894  109  0  1   97   75   196 0.995  19.71
ccagtttccgcccttcccccccaaccagggtaagcacgctgtgctgttggcacagcccca
gaggggcagaacggtggactgtcaggcatggggatggcagggggccagaggtcacagctt
ctgatgttggtggcaatcccctgcccccatgtcctcccctggctcccccatccattccag
ACCACGTGACTGTTGAGATGTCTGTGAGGGTCAATGGGCGGAACATCGTCAAGGCCAATT
TCACCATCTACGACTGCAGCCGCACTGCACAAGTGTACCCCCACACAGC
gtgagtggcttgggtggcttgcctccagttggtggagggaggaacgcatccccgggaagg
gtctttgctttcagggggccctgagaagaaaaatcatagcatcgtagaggtagacaggcc
cttcagttgttcattcaccagcacatttattcattctacaataaatgcatactgcctgat

 2.10 Intr +  24350  24452  103  2  1   65  115    41 0.906   5.84
ttgtatacctcttgttagcaggcagctcactaccttaaagacccaatctttcccaggcag
ccccgatgatgagaaagacctttccctgtgctgggatctgccttttgggttctagttcct
gggacagggatgagttgaggggtggggaaccaggagttgaggggcctccttgtcttccag
CTGTACCAGCTGCCTGTCGGCACAGTGGCCCTGTTTCTGGTGCAGCCAGCAGCACTCCTG
TGTTTCCAACCAGTCTCGGTGCGAGGCCTCACCAAACCCCACG
gtaagccaggctagggggcccctccgcctctgctgtttcattaccttttttaaaaaattc
acatgttgagaatgtttcaatgcctttgcatattccgccttagctttggctttgacagct
atatggggctcatcacataccacggtgcgtttaacccatgccctatagttggacatacta

 2.11 Intr +  29586  29690  105  2  0  140  111    88 0.997  17.88
ggatggagggtggtggcgagtgggaggcacggggtggggctggtggccgttaggactgaa
tgactagtgttttctcctcaggaaggcaggactgaaccaggcaggctggggtgcagtgag
tcctcctgcctcttctctgaaatgcccctgtgtcaccctctccttctgtttcctctgcag
AGCCCTCAGGACTGCCCCCGGACCCTGCTCTCACCCCTGGCACCCGTGCCTACGGGTGGC
TCCCAGAACATCCTGGTGCCTCTGGCCAACACTGCCTTTTTCCAG
gtaagtagaagccaggccagcgccgggtggggccaggaggaggccggggagcacgcaggc
cactaactgcccccatgtcctggtgtgacccctgctctgggcccactgcagtgctttcgc
acctgtgtgggctttgcttttctttctctgagtttccaccttctgcatgaggaagcccca

 2.12 Intr +  32164  32253   90  0  0  133   89   112 0.978  17.15
cattggacgtgatggccaggaaggggattttgggggacgggacagcccatgcaaaggcct
gacagttcgaccaagcccacctttcccagcaggagcccgtggtgtcctgctggagttaga
gggcaatgcatgctggcttggttctcctcaaacccgcctcccactccctgtttcccacag
GGTGCAGCCCTGGAGTGTAGTTTTGGGCTGGAGGAGATCTTCGAGGCTGTGTGGGTGAAT
GAGTCTGTTGTACGCTGTGACCAGGTGGTG
gtgagtggggtgactccagcatgggcggagggcgggcctgcgttaagtccagatgctgta
cccctcaccccaccctgcctctctctaccttctggttcccccatccccagcagccccaac
ttcatctgcctccatgacacccatccccagcagagccccaggcattgcccatgcccccta

 2.13 Intr +  32457  32550   94  2  1  119   80    92 0.998  12.20
ggcggagggcgggcctgcgttaagtccagatgctgtacccctcaccccaccctgcctctc
tctaccttctggttcccccatccccagcagccccaacttcatctgcctccatgacaccca
tccccagcagagccccaggcattgcccatgccccctatgctcttttctgcccttttgcag
CTGCACACGACCCGGAAGAGCCAGGTGTTCCCGCTCAGCCTCCAACTAAAGGGGCGGCCA
GCCCGATTCCTGGACAGCCCTGAGCCCATGACAG
gtgggcacccccacccgccccacatggcctcggggcctcagtgcagtgggtggggctcag
ccttgtgcgactcattccagtggttgccccaaagccgcagatgtcccaccccattgttct
ccagcacacacacagcctcatatcccagccctgccatgccatgccaggctccaggccttg

 2.14 Intr +  32783  32863   81  0  0  110   25    49 0.423   1.56
gggctcagccttgtgcgactcattccagtggttgccccaaagccgcagatgtcccacccc
attgttctccagcacacacacagcctcatatcccagccctgccatgccatgccaggctcc
aggccttggggtctccgtgcatagtttcccctgccttcctgggcctgatcgtccccatag
GAAACAGGACACAGTCCCTCTGCAGAGCTTGTAAGGACCTGATGAGCCAGGGCTCGCCCA
ACCTTGAGCGTGGCATCTGGG
gtgtggtcagctcccctcgcgtggcagctgtgcagttgctgtgactgtctgtgttgggtc
cactctccaggggctcctctgttcatggggagtctcaggcatccctggtggacgtggtgc
cctccagattcccaccatgaaggtcccagaacggccctgcatacccaaggtcctggagaa

 2.15 Intr +  33529  33683  155  2  2   83  103   142 0.640  16.18
tttggggaaggggctaagaacctcaggggatcctgacccccagaatcaggacttcctctg
ggtggggcaccacaatgatggggcgcagacctcttgacagttgttgtgtgtggagggcac
agcggtgttggggcatgcaccgcagagcggggctgaccgagctgccccgtgtctccccag
TCATGGTCTATAACTGTGCCATGGGCAGCCCCGACTGTTCCCAGTGCCTGGGCCGCGAAG
ACCTGGGTCACCTGTGCATGTGGAGTGATGGCTGCCGCCTGCGGGGGCCTCTGCAGCCCA
TGGCTGGCACCTGCCCCGCCCCCGAGATCCACGCG
gtaagcatgcccagtggaggcacgtggcacccgcactccggcacggcgcatgcgcagtgc
cctcgagggtcccacttcttggggacccaaacggcacatacaccgacacatgggtgcagt
atcacctgtgaacaaaaggaagtgctctgcctcacagagctgatgtttcagtgggggagg

 2.16 Intr +  34169  34425  257  1  2   62   64   267 0.567  19.18
catggccaaacattgctcctggaagctgacctcagcatcctccaggagaccccctaagta
gcgtccccaggcccacgtgggctcagtaatgcacacccacatcctccttgccagcacagt
gacctgccaagtggccacagtcccagccccacctgagcctccagaccttcctctaagcag
TGGGTCTGCACGGCTGTGCCCTGCTGGGTGCCTGTGACTGTGGGCAGAAGCCTGCTGGCC
TGCAGCCTCAGATCCCATTCGCCCCTCTCTCGGGTCACCTGGCAGATTGAGCCCCTGAGT
GGCCCGTTGGACGGTGGGACCCTGCTGACCATCCGAGGAAGGAACCTGGGCCGGCGGCTC
AGTGACGTGGCCCACGGCGTGTGGATTGGTGGTGTGGCCTGTGAGCCACTGCCTGACAGA
TACACGGTGTCGGAGGA
gtgagtagccacggtgcccccacctaccttctccagcagtgccagcctctgctctgtcct
cctcactcctccctccccatcctctgtcctcactctgctgctttctggaagactgttgct
tcgtggcctccaggcctgtgccgaagccattcccaccacacatcctgccgtttctgcttg

 2.17 Intr +  35027  35177  151  2  1  -14   79   215 0.332  11.75
cgtgtggaagagccgtcatctaccagcccagcagacgttctcatgatcagagaccctttt
gtcccacccccgtgtcttatagttgcagaactgtgggaaactgatggggtaaattataca
tagaaggcattggaagtgtggcatggcgtggaatggggcgatccctgagcctggctctag
GGTGGCCGTGGGGGCCAAGGACCGCTGGCTGACCACAGCACCTCCCCTCAGGATCGTGTG
TGTCACAGGGCCAGCCCCAGGACCACTCTCAGGTGTGGTGACCGTGAACGCCTCTAAGGA
GGGCAAGTCCCGGGACCGCTTCTCCTACGTG
gtaagggggggctgcagcccactgtccggcccgcccagcacgcacactcccgggggctgg
cccgaggcccaaacgcctgccttcctcccacagctgcccctggtccactccctggagcct
accatgggccccaaggccgggggcaccaggatcaccatccatgggaatgacctccatgta

 2.18 Intr +  35271  35410  140  2  2  103   69   212 0.977  21.24
acagggccagccccaggaccactctcaggtgtggtgaccgtgaacgcctctaaggagggc
aagtcccgggaccgcttctcctacgtggtaagggggggctgcagcccactgtccggcccg
cccagcacgcacactcccgggggctggcccgaggcccaaacgcctgccttcctcccacag
CTGCCCCTGGTCCACTCCCTGGAGCCTACCATGGGCCCCAAGGCCGGGGGCACCAGGATC
ACCATCCATGGGAATGACCTCCATGTAGGCTCCGAGCTCCAGGTCCTGGTGAACGACACA
GACCCCTGCACGGAGCTGAT
gtaagcctctgggcctggcccatcccttccagcccagagaaatcaatgggcttgggggct
ggcgggctggaggtgacatccttgagccaagcctctcttgggtcttcattggctgtgtcc
cctaagccaagccccttctcctctctgagcctcagtttcctcagctggtaagaatagtac

 2.19 Intr +  36175  36342  168  1  0   96   94   241 0.999  25.76
ggaatttggaagtgtaaggaaacagctgggcactaactgggcagaagatgagttgggacc
agtcaaggaggccttgaaccccaggccaagtgcgtggacttgtgccccaggtctcagggg
cattggcggtgggtgagcagcagaaggcaggccctgctgataacctgctgctccccccag
GCGCACAGATACCAGCATCGCCTGCACCATGCCTGAGGGGGCCCTGCCGGCTCCGGTGCC
TGTGTGTGTGCGCTTCGAGCGTCGGGGCTGCGTGCACGGCAACCTCACCTTCTGGTACAT
GCAGAACCCGGTCATCACGGCCATCAGTCCCCGCCGCAGCCCTGTCAG
gtgagactggcaccccgcccttcccccaggctctctggggctgcaggtgcactgataggt
tttgctgtcccccgcagtggcggcaggaccatcacagtggctggtgagcgtttccacatg
gtgcagaatgtgtccatggccgtccaccacattggccgggagcccacggtgaggcattcg

 2.20 Intr +  36372  36510  139  0  1   89   89   135 0.516  15.35
tcgcctgcaccatgcctgagggggccctgccggctccggtgcctgtgtgtgtgcgcttcg
agcgtcggggctgcgtgcacggcaacctcaccttctggtacatgcagaacccggtcatca
cggccatcagtccccgccgcagccctgtcaggtgagactggcaccccgcccttcccccag
GCTCTCTGGGGCTGCAGGTGCACTGATAGGTTTTGCTGTCCCCCGCAGTGGCGGCAGGAC
CATCACAGTGGCTGGTGAGCGTTTCCACATGGTGCAGAATGTGTCCATGGCCGTCCACCA
CATTGGCCGGGAGCCCACG
gtgaggcattcgggggcctgatgggtgggagggggtggcccaggcacagccagggcccta
actgaccaggcctcctcccactgcatctctgtcccctcttcctccctctgcctctgtgtc
tcctcaaaccccactccccaccgtttctccatgcccatctgtccatcctgcatcccggcc

 2.21 Intr +  36716  37000  285  1  0   55   49   428 0.670  34.39
tgggagggggtggcccaggcacagccagggccctaactgaccaggcctcctcccactgca
tctctgtcccctcttcctccctctgcctctgtgtctcctcaaaccccactccccaccgtt
tctccatgcccatctgtccatcctgcatcccggcctgggcccctggctctcctgcaccag
CTCTGCAAGGTTCTCAACTCCACCCTCATCACCTGCCCGTCCCCCGGGGCCCTGAGCAAC
GCATCAGCGCCAGTGGACTTCTTCATCAATGGGCGGGCCTACGCAGACGAGGTGGCTGTG
GCTGAGGAGCTACTGGACCCCGAGGAGGCACAGCGGGGCAGCAGGTTCCGCCTGGACTAC
CTCCCCAACCCACAGTTCTCTACGGCCAAGAGGGAGAAGTGGATCAAGCACCACCCCGGG
GAGCCTCTCACCCTCGTTATCCACGTGAGCACCAAAGGGGCCGGG
gtaggcgggggcaagcgagccagcctcagctgtgggcctcgggagcacttccccatgagc
atcctccccctttgcacccacagaaggagcaggacagcctggggctccagagtcacgagt
accgggtcaagataggccaagtaagctgcgacatccagattgtctctgacagaatcatcc

 2.22 Intr +  37084  37233  150  0  0   89   79   219 0.999  22.65
cccacagttctctacggccaagagggagaagtggatcaagcaccaccccggggagcctct
caccctcgttatccacgtgagcaccaaaggggccggggtaggcgggggcaagcgagccag
cctcagctgtgggcctcgggagcacttccccatgagcatcctccccctttgcacccacag
AAGGAGCAGGACAGCCTGGGGCTCCAGAGTCACGAGTACCGGGTCAAGATAGGCCAAGTA
AGCTGCGACATCCAGATTGTCTCTGACAGAATCATCCACTGCTCGGTCAACGAGTCCCTG
GGCGCGGCCGTGGGGCAGCTGCCCATCACA
gtgagtggatggggcgccggagcagggcagacctggccccacccctggcccatctgccaa
gcatctgcccctcacccagcacctgaattcactgagcgttttcacgctcaacagctcagt
ccagcaaagcagagctttacatccccacttgacatatgaggaaactgaggcccaagaact

 2.23 Intr +  37313  37429  117  1  0   50   78    85 0.757   5.53
taggccaagtaagctgcgacatccagattgtctctgacagaatcatccactgctcggtca
acgagtccctgggcgcggccgtggggcagctgcccatcacagtgagtggatggggcgccg
gagcagggcagacctggccccacccctggcccatctgccaagcatctgcccctcacccag
CACCTGAATTCACTGAGCGTTTTCACGCTCAACAGCTCAGTCCAGCAAAGCAGAGCTTTA
CATCCCCACTTGACATATGAGGAAACTGAGGCCCAAGAACTTAGTGACTTGCTTGAG
gtcagtgatgggccccatctggacctggaccatcagaaaccataagaaattgtccctgtc
ccccttggcgtctatcctagagcctgggctgccaggcaccatgtagaggcaggggagcag
gaggagcagagaggggccagaacactatctccttgcatgtctcctgggatggggagctca

 2.24 Intr +  38062  38176  115  0  1   62   82   286 0.935  26.59
gccctcatttagccttcccagtgtccccaggaggtggacattgttatctctatgttatca
gtgtggcacctgaggctcagagaggttaggtaatttacccagggccacacagcaagtgag
gagcagaactagagtataagtccaggaaagctacaacccccttccccaacctctgcacag
ATCCAGGTAGGGAACTTCAACCAGACCATCGCCACACTGCAGCTGGGGGGCAGCGAGACG
GCCATCATCGTGTCCATCGTCATCTGCAGCGTCCTGCTGCTGCTCTCCGTGGTGG
gtaaggagccccaccctcaggacaccttggagggcaggcttgccaccttgccccagcccc
tctgaagattggcagatgggagaaggcaggatgggatggggcacagcttgaacaaaggct
tggccatgggaacaggttaggcacccagaggttgggggaggtgtgccctggctccagcac

 2.25 Intr +  40214  40321  108  0  0  110   67   244 0.982  25.92
acgggagagctccccgcaactccccaccccccaccccaaccctgcccaggagggaggact
gcagggcctcctcccacaccctgcccagaggagctggagcggaggccagaatacagcagg
cgccaataaaggctttccaaagggcaccagaggcctgacctgcctctccactgcccgcag
CCCTGTTCGTCTTCTGTACCAAGAGCCGACGTGCTGAGCGTTACTGGCAGAAGACGCTGC
TGCAGATGGAGGAGATGGAATCTCAGATCCGAGAGGAAATCCGCAAAG
gtagtgggcggggaccctgcagggctgggcctcaactttccctcctaggggatgggttct
cgggccgctcacggctgtccgtgtgtccgccaggcttcgctgagctgcagacagacatga
cagatctcaccaaggagctgaaccgcagccagggcatccccttcctggagtataagcact

 2.26 Intr +  40370  40527  158  0  2   80   82   249 0.955  24.42
gacctgcctctccactgcccgcagccctgttcgtcttctgtaccaagagccgacgtgctg
agcgttactggcagaagacgctgctgcagatggaggagatggaatctcagatccgagagg
aaatccgcaaaggtagtgggcggggaccctgcagggctgggcctcaactttccctcctag
GGGATGGGTTCTCGGGCCGCTCACGGCTGTCCGTGTGTCCGCCAGGCTTCGCTGAGCTGC
AGACAGACATGACAGATCTCACCAAGGAGCTGAACCGCAGCCAGGGCATCCCCTTCCTGG
AGTATAAGCACTTCGTGACCCGCACCTTCTTCCCCAAG
gtcagcccgagcctgagcctgccctgaacctgtgccagccacctcaaggcaactcgacct
ctctgagccctgccagcctatagggtcccttgagcagtgccaaacctgcacagctgtccg
cagccgtcctggccacttgccctggcctgccacggggagaagggttggaggcagattctc

 2.27 Intr +  41388  41492  105  2  0   68  113    52 0.990   7.28
acccctggaattccacagcccccaggcttggcccactgcctcttagtcctttatggggag
ctaattccgtgccagtttcccccagcagcccaagccagtgcccctttctgtgtgagtgac
ctttccatgccagcagggggtgtccagccccgctgagatgctgggggtctgcctctgcag
TGTTCCTCCCTTTATGAAGAGCGTTACGTGCTGCCCTCCCAGACCCTCAACTCCCAGGGC
AGCTCCCAGGCACAGGAAACCCACCCACTGCTGGGAGAGTGGAAG
gtgagtaccccacgacccacacacagtgggctgcttcagggcaaccctgctcccccctgg
gtcccctttccagttcatctaatgcattgatccctgtcatgcggagttgggaggcatctg
ccattgtaaggtactgagccctccatcccaggaggcattcaggcagccattcagggtatt

 2.28 Intr +  42002  42132  131  1  2   85   71   232 0.986  21.87
ccacttttcaattcaaccaagctattgttccctgtcacaaaggttaggaggcatccaccg
tggaaggtaatgagctccccatcccaggaggcatacaagcagccgtcgtaagcactggct
gttaggctaggcagggacactgggcccctctggacaccccatcaccagttgcttccacag
ATTCCTGAGAGCTGCCGGCCCAACATGGAAGAGGGAATTAGCTTGTTCTCCTCACTACTC
AACAACAAGCACTTCCTCATCGTCTTTGTCCACGCGCTGGAGCAGCAGAAGGACTTTGCG
GTGCGCGACAG
gtcaggctgtgacagactggggtggggtagggaagaggagcctgtccaaggccacacagc
atcaggtcctgggtcctggggctctggggctcttgacacccccatattccagcccttcct
gggccgggatgcccaagaccttggctcacggggcacgatggttgctgtggacgtagaaga

 2.29 Intr +  42481  42679  199  1  1  105   76   489 0.998  49.97
ggacgtagaagaaggtggctgtttctccaggaggattctagccccactcacccctcgcag
gacccacccacacaggcactcctgggatcgatgggcccggggatgaggcggcactgagac
cctgggacccacagctcctagggcctcaaggtgcagttgacacctgcctcccgctcacag
GTGCAGCCTGGCCTCGCTGCTGACCATCGCGCTGCACGGCAAGCTGGAGTACTACACCAG
CATCATGAAGGAGCTGCTGGTGGACCTCATTGACGCCTCGGCCGCCAAGAACCCCAAGCT
CATGCTGCGGCGCACAGAGTCTGTGGTGGAGAAGATGCTCACCAACTGGATGTCCATCTG
CATGTACAGCTGTCTGCGG
gtgaggctgcctggggacagacagagcccaggcgggggacgtggcagggactcagcggca
gtgaccccacggcctcccaggccttccctggcaccctcaggccagctctgccaggaggga
gtgttgcatgagacaggccaggcccgtaggacctgttatgcagagaggggagccatggcc

 2.30 Intr +  44779  44925  147  0  0   80  114   319 0.998  35.32
tgtttaatgaacacgagcttagggtccgtggagacaccctggagaggagagtgttgacac
caggatccaaaaggagactgttggaggggttgggggacgggggcgtgaaggtgtttggcc
caaagcatgggggctggaatacagagggggccttggccctgatacccccgtgcccctcag
GAGACGGTGGGGGAGCCATTCTTCCTGCTGCTGTGTGCCATCAAGCAGCAAATCAACAAG
GGCTCCATCGACGCCATCACAGGCAAGGCCCGCTACACACTCAGTGAGGAGTGGCTGCTG
CGGGAGAACATCGAGGCCAAGCCCCGG
gtaagtcggcagggcggggagggtcccagggctgctgtgtcgccgccaacggcattgacc
cagccttcctctgcagggccttgctgcctgggcactgacatagtgatggcagcaactcac
tgacctttctctcccactctccccctgcagaacctgaacgtgtccttccagggctgtggc

 2.31 Intr +  45076  45232  157  0  1  136   60   322 0.916  34.97
ctgcgggagaacatcgaggccaagccccgggtaagtcggcagggcggggagggtcccagg
gctgctgtgtcgccgccaacggcattgacccagccttcctctgcagggccttgctgcctg
ggcactgacatagtgatggcagcaactcactgacctttctctcccactctccccctgcag
AACCTGAACGTGTCCTTCCAGGGCTGTGGCATGGACTCGCTGAGCGTGCGGGCCATGGAC
ACCGACACGCTGACACAGGTCAAGGAGAAGATCCTGGAGGCCTTCTGCAAGAATGTGCCC
TACTCCCAGTGGCCGCGTGCAGAGGACGTCGACCTTG
gtgggtgggaatgggggcagagaccccgtgtcaggcgcttcagccggggctggcccctgc
cttgacgggaaacactcctttcacctggcatgggtgcatgaatgtggggacactgagagg
atccaatgaggccccctcagcaagaagctcttactctgtaggagacaagtcctgcagtgt

 2.32 Intr +  46116  46219  104  1  2  127   56   229 0.999  24.66
ccagctctttcctgccctccccattttacagatgggaaaatggaggctcagagagaggta
tggcttgcctcagtttacatggagagagcgagaggcctctccctatgtggctgggccggt
acctacccctcaggcccagctccctgcccggaccctgatggcctgtcccttgtcccccag
AGTGGTTCGCCTCCAGCACACAGAGCTACATCCTTCGGGACCTGGACGACACCTCAGTGG
TGGAAGACGGCCGCAAGAAGCTTAACACGCTGGCCCATTACAAG
gtgcagccctgccccccgcccccatttccccaccctcatgcccccaccccaacctccggc
ctctgacctcggcctctcccctcccatcagatccctgaaggtgcctccctggccatgagt
ctcatagacaagaaggacaacacactgggccgaggtagtgcgggtgcacgtgggaaggga

 2.33 Intr +  46310  46373   64  1  1  107   57    57 0.823   3.94
agcacacagagctacatccttcgggacctggacgacacctcagtggtggaagacggccgc
aagaagcttaacacgctggcccattacaaggtgcagccctgccccccgcccccatttccc
caccctcatgcccccaccccaacctccggcctctgacctcggcctctcccctcccatcag
ATCCCTGAAGGTGCCTCCCTGGCCATGAGTCTCATAGACAAGAAGGACAACACACTGGGC
CGAG
gtagtgcgggtgcacgtgggaagggagcccaggctgcgtgtggacaggggcttccatccc
atgccccagtggggaagctgaggctccgagaggcagggctggcctgggctgaggcctcct
tggtgggggctgggcggggccagcctcctctgacccagtactgctggggcagggcccaca

 2.34 Intr +  47296  47330   35  2  2  114   97    23 0.997   4.87
tgactgtctctttggatctctgtctccgtttctgtttctctctccatctttctgtctctg
cttctgtttctctccccatctttctgtcttgtttctgtttctcactccatctttctgtct
tcatttctgtttctctcctctcctctcccgtgtttatttattgtgtttttcctctcacag
TGAAAGACTTGGACACAGAGAAGTATTTCCATTTG
gtgagtgcccaacctcggccccgggggatccagcccctcagtgggtgtggccttggcttt
ctgtggccctgggcctcttgggaaaagtgctcccagccctgcgaaaggctggggggtggg
ggagtagggatggggcccagaatcaggagggaaccacagcccttgtgtgctaagaagcat

 2.35 Intr +  47585  47689  105  1  0   84  113   186 0.999  22.28
ctcttgggaaaagtgctcccagccctgcgaaaggctggggggtgggggagtagggatggg
gcccagaatcaggagggaaccacagcccttgtgtgctaagaagcatggcagagccagacc
tcccacaggcggccgaggatggggcctggtgcggacactgaccactgcccggcctcccag
GTGCTGCCTACGGACGAGCTGGCGGAGCCCAAGAAGTCTCACCGGCAGAGCCATCGCAAG
AAGGTGCTCCCGGAAATCTACCTGACCCGCCTGCTCTCCACCAAG
gtgagtccggcctcagtctcccctctgtgcagtgggtacaaggctccagccccagctcca
gagggtcattgctcagggccagctgtgcacccgcggctgggagaggggtgtgagttcttc
ctgtttcccctgtggggctggaggggcaagaggctgaaggcttagggtcccacttgagga

 2.36 Intr +  48236  48399  164  1  2  101   43   277 0.986  24.47
ttagtcctttcaacgcctctgggaggcaagtgagccagagaggctcggtgaccagcctga
tgccatgtggcttcctcattcagcagcctggcatttcaagctccgcagagccaccaaggg
tgcccactagccctctgcacgtggcccggggctgacggcggccaccccactcccccgcag
GGCACGTTGCAGAAGTTTCTGGATGACCTGTTCAAGGCCATTCTGAGTATCCGTGAAGAC
AAGCCCCCACTGGCTGTCAAGTACTTTTTCGACTTCCTGGAGGAGCAGGCTGAGAAGAGG
GGAATCTCCGACCCCGACACCCTACACATCTGGAAGACCAACAG
gtggcgggtgggggggccgtgtggacttcactgtgccactggggcccctgtggcaggggg
ttcagagtctagtcttctggcctcgcctgcttggggtcaagccctcctctgccatttccc
agctgtgtgttctcggatgagtgacttagcctctctgtgcttcagtttcccctccactgt

 2.37 Intr +  49444  49591  148  1  1   95   82   345 0.998  36.02
gccccactgcaccccagctggccagggataggcaaactaaggttcccaaaggtcacatct
tgtgacaaggctccaacctcaggcccttgagggacaaagccagctctctcctccacaact
gtccctcgactgcttcctaccccaccctaccctcactgtctttgtcaccctaccccacag
CCTTCCTCTCCGGTTCTGGGTGAACATCCTGAAGAACCCCCAGTTTGTCTTTGACATCGA
CAAGACAGACCACATCGACGCCTGCCTTTCAGTCATCGCGCAGGCCTTCATCGACGCCTG
CTCCATCTCTGACCTGCAGCTGGGCAAG
gtcagctgttcccaggaccaggccaggcccatgcacagggccagagtggggtgccgacca
tgggtagcctcctcgactctctgaggctgagctcagagatcttcctgggaggggaaccaa
aagatctcaggtctaggggatgtgggatgagtgactcattcagacagggagacacctaga

 2.38 Intr +  50796  50936  141  2  0  110   45   365 0.990  36.13
gagcccctggtctggggccggctgagtgcggggacgttcagtgaccgggtgagactcttt
gggcctcgggggcctgctaaggtcacttatgtggcaggagggatgagggctcatccagaa
aacgaccagatccgtcctttctccagcagccatctaacaccctcgctcttctctgcccag
GATTCGCCAACCAACAAGCTCCTCTACGCCAAGGAGATTCCTGAGTACCGGAAGATCGTG
CAGCGCTACTACAAGCAGATCCAGGACATGACGCCGCTCAGCGAGCAAGAGATGAATGCC
CATCTGGCCGAGGAGTCGAGG
gtgcggtggctcggcggcgggggatgggggcctgaagagctgagggatcgggggtcgggg
gctgggcctcaatgcctccactggagtaagggcagggagcgcagagggcatttcagaagt
ggctgtggcctcttgctggcctgcaaattcgtcatgcattttcccagagtttgaggagcg

 2.39 Intr +  51328  51402   75  0  0  103  109   148 0.999  19.26
agattggacttcagggtccgggaagccgtcttcgtccatgggacttgaggggcctcatcg
ctgaactgttctgtgggggccgtggggagttggggattgtgtgcaagcagctggctttgc
tgggactaggctcagctttgaccgctgggctaacctcctccccatcctgcctccttatag
AAATACCAGAATGAGTTCAACACCAATGTGGCCATGGCAGAGATTTATAAGTACGCCAAG
AGGTATCGGCCGCAG
gtgagtgccccagggtgaggcacctgccctcggggtaggtgagcttcctactcaaggaca
cacatctcagggtgcttgcccctaatggacggatgtcactcgtggtagacgttcaggggt
gtgttctctcccacgaactgaggcagggctaccggccatggcccggctgactccgctgct

 2.40 Intr +  51591  51696  106  2  1   97   51   208 0.634  18.95
cccagggtgaggcacctgccctcggggtaggtgagcttcctactcaaggacacacatctc
agggtgcttgcccctaatggacggatgtcactcgtggtagacgttcaggggtgtgttctc
tcccacgaactgaggcagggctaccggccatggcccggctgactccgctgctcccctcag
ATCATGGCCGCGCTGGAGGCCAACCCCACGGCCCGGAGGACACAACTGCAGCACAAGTTT
GAGCAGGTGGTGGCTTTGATGGAGGACAACATCTACGAGTGCTACA
gtgaggcctgagacacatggagagttggtcaggctgctgctgggagaaatggacgcccac
tgggcctcaacttgatcttctaccccgtgcctgtgactcagactgggaaatactgagcag
agacggctggggcgggggcaggaggaggggctgctctctgagacaggggcgcccccgcct

 2.41 Term +  52014  52144  131  1  2   45   43   113 0.557   1.78
gcaggaggaggggctgctctctgagacaggggcgcccccgccttgacccctgggcacctc
catcccctcccacctgtccccagatcagtctctgggatggaggccagagagctggtcagg
ctcccccatctgcccagcacggcctgcactgtgcccacccacttgctccacaacgtccag
TTGGTCCTGCTGCCAAGAGCCCCGTGCATCCAGGCGGCCAAGCACAAACTGGGGGAGAGG
AGGCCGCCAGCCCGGAGGCTGCAGCCCAGAAACTCTACCTCATCCACACTGGTGCAGGGA
GCCCTCCTTGA
actgacctttgattggtttctgcttcaactaccaaaatgttatctccacttccccctcac
ccgtagaggatcctggccacagacagtttcaagtagtgtcagatttttgttgcttgggcg
gctgttggtagagtgggcagtgcccgcgccatggggtgctctgtgggcttctccaggagc

Predicted peptide sequence(s):


>PLXND1_1|GENSCAN_predicted_peptide_1|464_aa
MAPRAAGGAPLSARAAAASPPPFQTPPRCPVPLLLLLLLGAARAGALEIQRRFPSPTPTN
NFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRL
TDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSML
NVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPSDPPPGAQSYAYLA
LNSEARAGDKESQARSLLARICLPHGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRLVS
VFPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLD
SVVQGTGPACERKLNIQVHPGGGGGGGGGGGGGGGGGGREPSGS

>PLXND1_1|GENSCAN_predicted_peptide_2|1833_aa
MADLVPEGTLWLLVCIGPARCWQDPGAEALTRSPHCGWTSSWNPARRCLRKAPSSPVFLA
VSTAVSTGSMLENVMHVLPWEMCDQHSAITGVGGLSHILKTCRLGMPGEGTAWVQTPGAL
KCQGEYECLRGMGWALAAEGTFTMVQEPRLQPEQLDCGAAHLQHPLSILQPLKATPVFRA
PGLTSVAVASVNNYTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPA
DSGYLYLMTSHQMARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCTNSSQQH
FWTSASEGPSRCPAMTVLPSEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTVAR
VPGPAFGHQIAYCNLLPRDQFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQV
YPHTACTSCLSAQWPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGS
QNILVPLANTAFFQGAALECSFGLEEIFEAVWVNESVVRCDQVVLHTTRKSQVFPLSLQL
KGRPARFLDSPEPMTGNRTQSLCRACKDLMSQGSPNLERGIWVMVYNCAMGSPDCSQCLG
REDLGHLCMWSDGCRLRGPLQPMAGTCPAPEIHAWVCTAVPCWVPVTVGRSLLACSLRSH
SPLSRVTWQIEPLSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEE
VAVGAKDRWLTTAPPLRIVCVTGPAPGPLSGVVTVNASKEGKSRDRFSYVLPLVHSLEPT
MGPKAGGTRITIHGNDLHVGSELQVLVNDTDPCTELMRTDTSIACTMPEGALPAPVPVCV
RFERRGCVHGNLTFWYMQNPVITAISPRRSPVRLSGAAGALIGFAVPRSGGRTITVAGER
FHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFINGRAYADEVAVA
EELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHVSTKGAGKEQDSL
GLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAVGQLPITHLNSLSVFTLNSSVQQ
SRALHPHLTYEETEAQELSDLLEIQVGNFNQTIATLQLGGSETAIIVSIVICSVLLLLSV
VALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGDGFSGRSRLSVCPPGFAELQTD
MTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQGSSQAQETHPL
LGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRDRCSLASLLTIAL
HGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRETVGE
PFFLLLCAIKQQINKGSIDAITGKARYTLSEEWLLRENIEAKPRNLNVSFQGCGMDSLSV
RAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDG
RKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQ
SHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQAEKRG
ISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQ
LGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEESRKYQNEFNTNV
AMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYECYIGPAAKSPVH
PGGQAQTGGEEAASPEAAAQKLYLIHTGAGSPP