GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:00:55

Sequence PLXNB1_1 : 22762 bp : 59.28% C+G : Isochore 4 (57 - 100 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1201   2307 1107  0  0   91   89  1341 0.820 127.48
ggtcctggggtcatcctggacatagtgcctatctaagaagcctggtcctcctctgctcac
cccctaggttaggaggagcatcttggcaatgccacagtcctatcccttaccagtggcccc
agggtgctctggcggccacgtgagccccactctctcgacctctcttcctgccaggtgacc
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTC
CAGCCCCTTCCACCAACTGCATTCACTCCCAATGGCACGTATCTGCAGCACCTGGCAAGG
GACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTG
CCACCTGTGATGCCTGATGAGTGCCCCCAGGCCCAGCCTACCAACAACCCGAATCAGCTG
CTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACA
CAATATGTGGCTGCCAATGATCCTGCGGTCAGCACGGTGGGGCTGGTAGCCCAGGGCTTG
GCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTAT
GAGGAGACAGCCAAGCTGGCAGTGGGCCGCCTCTCCGAGTACAGCCACCACTTCGTGAGT
GCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCC
TATGTGGAGTTGCCTCTGGCCTGCGAAGGTGGCCGCTACGGGCTGATCCAGGCTGCAGCT
GTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCC
CTCTGTGCCTTCCCCCTGGATGAGGTGGACCGGCTTGCTAATCGCACGCGAGATGCCTGC
TACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTG
gtgagttccagtattgccccacttttccgcctctctgaggccactggccaagcatttgca
gccaaggagctgcccagagagtccgagggcagctggtggtagcacgaggatgatcagatc
agcaaatattaagtgcttcctatgttgcctgggcagtggaagggtaccttaccacaaatc

 1.02 Intr +   2865   3047  183  2  0   78   84   154 0.823  15.19
aaaaagggaagagagactgggggcggggatgaggttgtcccaggagggccagcagagaaa
acacagttgtacagggagagctaccagagcggctgggggagggaatgaggttgtccaggg
acgatgcggccgaggaggttatccagggagggccttcctgatgcttcttgctgcctatag
GACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGG
GTCCCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCA
GTCACCATGGAAGATGGACACACCATCGCTTTCCTGGGTGATAGTCAAGGGCAGCTGCAC
AGG
gtgagcccacaggaagtactggcccctgccccagagtctggagggaacagattgctaggg
acccagcctggtttaagctatccctgtgacccctgggccaggagagatgacctgagctcc
tctccccaggactgggtggtgtttacctgtgactttcctccatccccgctaggccagttg

 1.03 Intr +   3353   3481  129  1  0   62   79    70 0.916   5.57
ccaggactgggtggtgtttacctgtgactttcctccatccccgctaggccagttggtatg
acctgtgactgcctaggaggaaattctatttgtaaattacttcgattgggtggaggaggg
gagggctttgggcctctggccatggacttgggtcccagaccctgtggtctctgatcccag
GTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACC
CAGAGCACA
gtgagtgccaggcacaagccagggcatgactgctgggaggggcctctgggtggggccagg
gacccacttgtgggtgagccactggtgtttggattgctggcctcaggtcctctttgctgt
cacagcttctgaaggttcctgtggcttcctgtgctcagcacctggactgtgcatcttgcc

 1.04 Intr +   4549   4588   40  0  1   97   72    33 0.319   1.53
tgtgagccctggtctgctgcccactagccccaacagtgtgtccctggctctcttggcagg
ttttcctatcagtgccagacctgccacccctgtggccaggggagtcatattcctgccact
ttggggaacatcagagtcctgccctgctgactggttctggtgtgatgtgcccctccccag
ACCCTAGTGAGGCCCCAGTGCTGCCGAGAGGAGCCGGTGG
gtgagagaatgggccagcctggtgggggccagcccctgcttcaggggatgcggtggggtt
aaagtgtgaatccaggcaaagagccatgaatggatgcctttctctgggtcctcccactcc
ccaaccacctgaagcctccattctgtgcccttggactgtattccctcatcctgggtcctc

 1.05 Intr +   4856   4964  109  0  1  132   73   101 0.732  13.51
gaatggatgcctttctctgggtcctcccactccccaaccacctgaagcctccattctgtg
cccttggactgtattccctcatcctgggtcctcttccccattcaagggctcaggatatcg
gctctgggtctgagtgcacctccttgctgcttaaccctggccctctctccccctctgcag
ACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCC
TCTCTTTCTATGACTGTGTGGCGGTCACTGAACTCCGCCCATCTGCGCA
gtgagttcctcgccctgtccccaggcctgggcttccctgtggcgacccttgccccatggc
tgtgctctgtgcaggtgccaggcctgtgtgagcagccgctgggggtgtaactggtgtgtc
tggcagcacctgtgcacccacaaggcctcgtgtgatgctgggcccatggttgcaagccat

 1.06 Intr +   5039   5147  109  2  1  100  109    41 0.995   8.85
acgtatccgtgagcgtggagctcagatttggcgctgttgtgatcgccaaaacttccctct
ctttctatgactgtgtggcggtcactgaactccgcccatctgcgcagtgagttcctcgcc
ctgtccccaggcctgggcttccctgtggcgacccttgccccatggctgtgctctgtgcag
GTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTG
CACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAG
gtgagtgtgactttgggctgggccataccgggggggttgggggtcccagtgtgagagttt
ttctcatggcccggggtctgtctgcctatgtgaggctctgtcctgagcaccagagccgct
gtatgtgacggactccctggagaacagccgccgatacatcccgcctgttttgggagaggg

 1.07 Intr +   5555   6235  681  1  0  113   81   301 0.625  25.14
cggcacagacacccctggagccttcccccgcagttttctccagtggagaattaatgggct
gtttttatttctcttttccttggtctcctttcctcttaacatacactgtgcctgcctgcc
tcctgtcccgcgcctgcctgctgagtggcccttcctgtcttcctctgcctcccccttcag
AGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCCAGCCCCTCCCCACCCACA
GCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCC
TCCACAGCCACAGCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGG
GGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCCACAGGGTCGCCTCTCCAT
GAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACT
GACTTCAGACCCTCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAG
GTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTTCATCCCACAGTGCCCCTG
GACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAG
CCCGCCCTGGACTGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACG
GGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCAGGTGATGGAGACTCAGCA
GAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGAC
ACCCCCGGGCTCTGGGAGCTG
gtgaggcccagcccaggaaggaggcctcaggggaggggatgtggggaagatgctacccct
agcttgccttgtgattctgcactgggaggaggtgaggggcagggtggagtctgcagcccc
acaccggccttgcctctggaatctggcaaggcagagggctgagctgggcagggtgggctc

 1.08 Intr +   6446   6568  123  1  0   81   82   105 0.999  11.16
gggaggggatgtggggaagatgctacccctagcttgccttgtgattctgcactgggagga
ggtgaggggcagggtggagtctgcagccccacaccggccttgcctctggaatctggcaag
gcagagggctgagctgggcagggtgggctccatagactgccttgcccttggtgcctgcag
GAAGAGGCGACCTTGGGGGCAAGCTCCTGCCCCTGTGTGGAGAGCGTTCAGGGCTCCACG
TTGATGCCGGTCCATGTGGAGCGGGAAATCCGGCTGCTAGGCAGGAACCTGCACCTTTTC
CAG
gtcagtgtgtcctgcctgccgctgtccttgcagcctccttagctgttgagaaactctgca
caagccctggggagcaggaggagggcagagtccgagggctcaactccaacccagaagctg
tgctgggggatctgttgggtgacctgcaggactccctgggcccagctcctgaagctgccc

 1.09 Intr +   6773   6916  144  1  0   94   43   184 0.802  16.16
tccttgcagcctccttagctgttgagaaactctgcacaagccctggggagcaggaggagg
gcagagtccgagggctcaactccaacccagaagctgtgctgggggatctgttgggtgacc
tgcaggactccctgggcccagctcctgaagctgcccaacagctgtgttctctgccctcag
GATGGCCCAGGAGACAATGAGTGTGTGATGGAGCTGGAGGGCCTCGAGGTGGTGGTTGAG
GCCCGGGTCGAGTGTGAGCCACCTCCAGATACCCAGTGCCATGTCACCTGCCAGCAGCAC
CAGGTGCACACCATGAGCGCCTGG
gtgggcacgggtgcactgcactggccacaggctggctgccaactgtagctggctgcacca
cactttccagagccacgctctgaccgtgtcgccctgagggagtctccacacccatttctg
acctctgaccatgtgccccgtggagtccttgcatcccagctctgaactctaacttgagac

 1.10 Intr +   7270   7363   94  0  1  105   89   116 0.915  14.10
ttgagaccccatggggtccccatactccatttctggctctgccctccaacttgtggcccc
atggggtccctctgaccctatgctcctaactggtcgttttagtcctttctctgactaacc
cctccccaggcctgacacttcccccagtgcttgactctgaacccactcccatttctccag
CTCAGCTATGAGGCTCTGCAGCCGGAGCTCCGTGTGGGGCTGTTTCTGCGTCGGGCCGGC
CGTCTGCGTGTGGACAGTGCTGAGGGGCTGCATG
gtgagccacctgcgggctgctgggctggcggtggtagcagggctctcccaggcctgcctc
tcacgtgtgtctctgccacccccagtggtactgtatgactgttccgtgggacatggagac
tgcagccgctgccaaactgccatgccccagtatggctgtgtgtggtgtgagggggagcgt

 1.11 Intr +   7449   7571  123  1  0  104   65    71 0.507   8.13
gctcagctatgaggctctgcagccggagctccgtgtggggctgtttctgcgtcgggccgg
ccgtctgcgtgtggacagtgctgaggggctgcatggtgagccacctgcgggctgctgggc
tggcggtggtagcagggctctcccaggcctgcctctcacgtgtgtctctgccacccccag
TGGTACTGTATGACTGTTCCGTGGGACATGGAGACTGCAGCCGCTGCCAAACTGCCATGC
CCCAGTATGGCTGTGTGTGGTGTGAGGGGGAGCGTCCACGTTGTGTGACCCGGGAGGCCT
GTG
gtgaggctgaggctgtggccacccagtgcccagcgcccctcatccactcggtttgttgaa
aggctggccatcccttcctcagtgctgcccttagagggagggtgtgggggcccaaaggtg
ggaggttggggctgcctttccagttgagtagaggtgagcagtccttgtcctggaacaggt

 1.12 Intr +   7775   7901  127  0  1  -18  115   163 0.534   9.31
cagtgcccagcgcccctcatccactcggtttgttgaaaggctggccatcccttcctcagt
gctgcccttagagggagggtgtgggggcccaaaggtgggaggttggggctgcctttccag
ttgagtagaggtgagcagtccttgtcctggaacaggtggagccactgactgggcctgtag
ACGGAGGCACCCGTGTCACCATCAGGGGCTCCAACCTGGGCCAGCATGTGCAGGATGTGC
TGGGCATGGTCACGGTGGCTGGAGTGCCCTGTGCTGTGGATGCCCAGGAGTACGAGGTCT
CCAGCAG
gtaagctggctgcacccagcaggagcacggcgcagcctggggcctccgcggttggcgttg
ctgcttggggcctcccacccaccgctcatctgcccccctctctccctgttccttgatcct
ggccacaatgcccgagtgccagcgttgccactgaagaccctgagcacccaccacacctgt

 1.13 Intr +   9343   9466  124  1  1   45   82   183 0.558  15.16
aatattaattctcagataccaaggccttctgatgtgtcataaagaattccctccaaagtg
agagagggtctctgtcaatcttatggagcatgggaaggggaagaccacctgacagtaggg
cagggagaggggctgccaggtaagcttgaggggcccttgatgcagcctggcaccccctag
CCTGCCCTGTGCCTACAGCCTCGTGTGCATCACCGGGGCCAGTGGGGAGGAGGTGGCCGG
CGCCACAGCGGTGGAGGTGCCGGGAAGAGGACGTGGTGTCTCAGAACACGACTTTGCCTA
CCAG
gtacctgactgctgagccacccccagctgccagcgggccaacctctctggtggctcctct
caacccatctggttattccttggtggggctcccagtcctgggccagcctgtctctcaggc
tgtccctgcctccatgtgtctggtctgatgctcatctctctccctgtctgtcccacagga

 1.14 Intr +   9645   9781  137  2  2  150   42   101 0.999  12.25
aggtacctgactgctgagccacccccagctgccagcgggccaacctctctggtggctcct
ctcaacccatctggttattccttggtggggctcccagtcctgggccagcctgtctctcag
gctgtccctgcctccatgtgtctggtctgatgctcatctctctccctgtctgtcccacag
GATCCGAAGGTCCATTCCATCTTCCCGGCCCGCGGCCCCAGAGCTGGGGGCACCCGTCTC
ACCCTGAATGGCTCCAAGCTCCTGACTGGGCGGCTGGAGGACATCCGAGTGGTGGTTGGA
GACCAGCCTTGTCACTT
gtgagggccacttcctcatcctgcaaaaatccatctgctccaggggaaagatggaggggt
ctgagatcctggggagagcagaaaggggaagagggccagtctgctccttcagagagtggc
cagaccctccctagccagctgtggtgggagtgcacctccagggacacctggtggagactg

 1.15 Intr +  10053  10229  177  0  0   91   41   150 0.935  10.84
agggccagtctgctccttcagagagtggccagaccctccctagccagctgtggtgggagt
gcacctccagggacacctggtggagactgcagtcagcgcttgagggaagccagttggggc
ctgagtggtccaagttttccctgcctgcgcccctgcattcattcccacctcccctcccag
GCTGCCGGAGCAGCAGTCAGAACAACTGCGGTGTGAGACCAGCCCACGCCCCACGCCTGC
CACGCTCCCTGTGGCTGTGTGGTTTGGGGCCACGGAGCGGAGGCTTCAACGCGGACAGTT
CAAGTATACCTTGGACCCCAACATCACCTCTGCTGGCCCCACCAAGAGCTTCCTCAG
gtgttgggccaggggtgtggctgcatggcaggtggcagggaggtctttgcagctccacta
tgtgggggtttgtagggctttatgttgaggcactgagaatcccatgctgctagtaggggc
aaggggtcgtgtggtttggggctggggctgagctgacctagccgggactgggctgtgctt

 1.16 Intr +  10465  10636  172  1  1   36   21   113 0.459   0.54
cactatgtgggggtttgtagggctttatgttgaggcactgagaatcccatgctgctagta
ggggcaaggggtcgtgtggtttggggctggggctgagctgacctagccgggactgggctg
tgctttaggtccaggtaacataagccatcttacgttacgtaagctcacggtctgtttcag
TGGAGGACGTGAGATATGCGTCCGTGGCCAGAATCTGGACGTGGTACAGACGCCAAGAAT
CCGGGTGACCGTGGTCTCGAGAATGCTGCAGCCCAGCCAGGGGCTTGGACGGAGGCGTCG
CGTGGTCCCGGAGACGGCATGTTCCCTTGGACCCTCCTGCAGTAGCCAGCAA
gtaggacacccttgggtacccccacactctccccttgccccataccacaccctggggaca
gccagagcaggtgccagaggaggctcttcccatctttgcttggcccctcgtcaacctgcc
tgtcttccttccagtttgaggagccgtgccatgtcaactcctcccagctcatcacgtgcc

 1.17 Intr +  10771  11013  243  0  0  113   77   178 0.963  18.13
cccggagacggcatgttcccttggaccctcctgcagtagccagcaagtaggacacccttg
ggtacccccacactctccccttgccccataccacaccctggggacagccagagcaggtgc
cagaggaggctcttcccatctttgcttggcccctcgtcaacctgcctgtcttccttccag
TTTGAGGAGCCGTGCCATGTCAACTCCTCCCAGCTCATCACGTGCCGCACACCTGCCCTC
CCAGGCCTGCCTGAGGACCCCTGGGTCCGGGTGGAATTTATCCTTGACAACCTGGTCTTT
GACTTTGCAACACTGAACCCCACACCTTTCTCCTATGAGGCCGACCCCACCCTGCAGCCA
CTCAACCCTGAGGACCCCACCATGCCATTCCGGCACAAGCCTGGGAGTGTGTTCTCCGTG
GAG
gtacagctcctacttggacctggcagggccccgagacccttcccttggctggacagcact
gctgtgtgtggcggagaggccgagacagtagagcaagggccggtggatggacatggctcc
tcatccttgctgtggtgggggcagagggggctggtggggggtgcctagcctagcatctgg

 1.18 Intr +  11741  11917  177  1  0   92   73   242 0.715  24.42
aacaaagggtgatgaggagcagcttggaggacactgtgtgactggcctgcactcgggaag
ggtgctgagaggctgtcagctttgctgctgcggctgggtctcagggtccttcccacattt
ggggaggacaggatctgagggaagggtcctgagtgactgatcggtgaccctctgttccag
GGGGAGAACCTGGACCTTGCAATGTCCAAGGAGGAGGTGGTGGCTATGATAGGGGATGGC
CCCTGTGTGGTGAAGACGCTGACGCGGCACCACCTGTACTGCGAGCCCCCCGTGGAGCAG
CCCCTGCCACGGCACCATGCCCTCCGAGAGGCACCTGACTCTTTGCCTGAGTTCACG
gtcagtgggcaggtccctggccgggctgggcattgacctgggccaaacccttgctcacag
gtggctcctgacacaggtgcagatggggaacttgcgcttctccctgggtcacgtgcagta
tgacggcgagagccctggggcttttcctgtggcagcccaggtgggcttgggggtgggcac

 1.19 Intr +  11994  12142  149  2  2   54   94   139 0.990  11.32
agacgctgacgcggcaccacctgtactgcgagccccccgtggagcagcccctgccacggc
accatgccctccgagaggcacctgactctttgcctgagttcacggtcagtgggcaggtcc
ctggccgggctgggcattgacctgggccaaacccttgctcacaggtggctcctgacacag
GTGCAGATGGGGAACTTGCGCTTCTCCCTGGGTCACGTGCAGTATGACGGCGAGAGCCCT
GGGGCTTTTCCTGTGGCAGCCCAGGTGGGCTTGGGGGTGGGCACCTCTCTTCTGGCTCTG
GGTGTCATCATCATTGTCCTCATGTACAG
gtgggtgcagccagatgtggctgggctggggcaggtcgtgggatctggctggactgggaa
gggacagaccgggccaggagtcaggaaacattctctgtaaatggccagagagtaaatatt
ttcgctttgcaggccaagtggtctctgttcaacaactcagctttgccactgtggcacaaa

 1.20 Intr +  12643  12743  101  1  2    5   64   154 0.997   5.62
ggtgtgtgtgacttgcttgggacgggacaggctgaatcgtactgggctaggcttgagctt
ggctggcatggctgcattggactgtgctggatgaggccggggtgtgcctggggattgtca
ggcaggcctgggcgagtaggactcatctggccatcctctcctgaccctggggctgagcag
GAGGAAGAGCAAGCAGGCCCTGAGGGACTATAAGAAGGTTCAGATCCAGCTGGAGAATCT
GGAGAGCAGTGTGCGGGACCGCTGCAAGAAGGAATTCACAG
gtgtggctgggagaatgggccccgccctccagaactctgcccaaacccactcccatcaca
cgggattggtgcttaacaggtgcttaacctggcctcttctgcttaacagacctcatgact
gagatgaccgatctcaccagtgacctcctgggcagcggcatccccttcctcgactacaag

 1.21 Intr +  12853  13070  218  2  2  109   75   332 0.999  33.44
taagaaggttcagatccagctggagaatctggagagcagtgtgcgggaccgctgcaagaa
ggaattcacaggtgtggctgggagaatgggccccgccctccagaactctgcccaaaccca
ctcccatcacacgggattggtgcttaacaggtgcttaacctggcctcttctgcttaacag
ACCTCATGACTGAGATGACCGATCTCACCAGTGACCTCCTGGGCAGCGGCATCCCCTTCC
TCGACTACAAGGTGTATGCGGAGAGGATCTTCTTCCCTGGGCACCGCGAGTCGCCCTTGC
ACCGGGACCTGGGTGTGCCTGAGAGCAGACGGCCCACTGTGGAGCAAGGGCTGGGGCAGC
TCTCTAACCTGCTCAACAGCAAGCTCTTCCTCACCAAG
gtacccccagctgcatcttcctggcctgcccctggccctgccccttctccagggcatggt
ttctgagcccgcccctctgtccccctaaaccccttttcccatcccttctctttggctgca
gttcatccacacgctggagagccagcgcaccttttcagctcgggaccgtgcctacgtggc

 1.22 Intr +  13192  13370  179  0  2   87   62   261 0.992  23.32
tggagcaagggctggggcagctctctaacctgctcaacagcaagctcttcctcaccaagg
tacccccagctgcatcttcctggcctgcccctggccctgccccttctccagggcatggtt
tctgagcccgcccctctgtccccctaaaccccttttcccatcccttctctttggctgcag
TTCATCCACACGCTGGAGAGCCAGCGCACCTTTTCAGCTCGGGACCGTGCCTACGTGGCA
TCTCTGCTCACCGTGGCACTGCATGGGAAGCTTGAGTATTTCACTGACATCCTCCGCACT
CTGCTCAGTGACCTGGTTGCCCAGTATGTGGCCAAGAACCCCAAGCTGATGCTGCGCAG
gtctgtgtggctgttggggctgggtgggccctggacagctggagctggggtggggcctcg
ggctggggggtctgcaggatagagaggcccgcagccccacctgctgaccctggcactccc
ctttcccatcatctcaggacagagactgtggtggagaagctgctcaccaactggatgtcc

 1.23 Intr +  13508  13574   67  2  1   92   72   108 0.982   9.65
ttgcccagtatgtggccaagaaccccaagctgatgctgcgcaggtctgtgtggctgttgg
ggctgggtgggccctggacagctggagctggggtggggcctcgggctggggggtctgcag
gatagagaggcccgcagccccacctgctgaccctggcactcccctttcccatcatctcag
GACAGAGACTGTGGTGGAGAAGCTGCTCACCAACTGGATGTCCATCTGTCTGTATACCTT
CGTGAGG
gtgagggggcagaggtggacagggctcctgtccagggagggtcaggccctccaaacttct
aagccctcagccaccatgcagctcggacacttgtgccagagcagagactcctgctcagcc
tgtcctcagtccccttaagcccatgtcctgtccccttccccagtgtgcgtcatgtcccat

 1.24 Intr +  13803  13988  186  2  0  101   77   206 0.505  21.89
ctccaaacttctaagccctcagccaccatgcagctcggacacttgtgccagagcagagac
tcctgctcagcctgtcctcagtccccttaagcccatgtcctgtccccttccccagtgtgc
gtcatgtcccatacacctctgccacctgctggggggccctaactgcctgtgctctcctag
GACTCCGTAGGGGAGCCTCTGTACATGCTCTTTCGAGGGATTAAGCACCAAGTGGATAAG
GGGCCAGTGGACAGTGTGACAGGCAAGGCCAAATACACCTTGAACGACAACCGCCTGCTC
AGAGAGGATGTGGAGTACCGTCCCCTGGTGAGGGTGTGCAAGTGTGTGGCCTGCAGTCTG
AGTGCG
gtgagggcgagggtggagagtgtgtgggtgtgtggggtctggacaccagcttctgatgtg
gtacctggatgtagagctgggttgacctctggctggctcctggagagagcccatcagact
agcttagcaggatagcagtttagggcagactttgatgataaggcctctatgtgccccagg

 1.25 Intr +  14776  14944  169  0  1   91   73   145 0.996  14.02
aatggggaggaagctgctgtccctggggaaggcaggcaggtgaagagacgagaattaggg
attgtgtggtgcgtggggattggaggcagcagtttctcatgagttgtctctgcccttggc
ctgtgtcttggtcatcctgagtgcacatgaaccctgatggctcctgtgtgtcctgcacag
ACCTTGAATGCACTATTGGCTGTGGGGCCTGGGGCAGGAGAGGCCCAGGGCGTGCCCGTG
AAGGTCCTAGACTGTGACACCATCTCCCAGGCAAAGGAGAAGATGCTGGACCAGCTTTAT
AAAGGAGTGCCTCTCACCCAGCGGCCAGACCCTCGCACCCTTGATGTTG
gtgagggcgtggagagcccctggggacctgagccactgttgggcctgggctggccccgga
ccaactctgcagggacaactcatcactcagggtggggaggatgctgggaggcaggcagaa
gctggctttggaacatctttcttggacagcctctcatctggggagggggtccctgctctt

 1.26 Intr +  15254  15357  104  0  2   99   97    52 0.993   8.26
ggaacatctttcttggacagcctctcatctggggagggggtccctgctcttggtctttgg
agaggttgagtaaggctgccccatgatggaggggctggtgtccctgtggaggaggagatg
ggctccactatgggaagggtatcttccagccctgcacccagttctgccttgcccttgcag
AGTGGCGGTCTGGGGTGGCCGGGCACCTCATTCTTTCTGACGAGGATGTCACTTCTGAGG
TCCAGGGTCTGTGGAGGCGCCTGAACACACTGCAGCATTACAAG
gtaggaggagtgggagctggaggagggcatggtggggtgggactggtggagggatcacca
gctgtgctcagcaggtcccagatggagcaactgtggccctcgtcccctgcctcaccaagc
atgtgctccgggaaaaccaggattatgtccctggagagcgtgagtaccgctcccatcacg

 1.27 Intr +  15432  15516   85  2  1   -3   75   105 0.577   0.65
agagtggcggtctggggtggccgggcacctcattctttctgacgaggatgtcacttctga
ggtccagggtctgtggaggcgcctgaacacactgcagcattacaaggtaggaggagtggg
agctggaggagggcatggtggggtgggactggtggagggatcaccagctgtgctcagcag
GTCCCAGATGGAGCAACTGTGGCCCTCGTCCCCTGCCTCACCAAGCATGTGCTCCGGGAA
AACCAGGATTATGTCCCTGGAGAGC
gtgagtaccgctcccatcacggtcctctgcccctgctgtgcccagcccggagtcatgggg
aaggtcctctgggcctcagggcaggcttgtgcctatttccattcggcccaggaaatccct
caaccaggtgcccccacccctgggagagctggcaagaaacagggggcctggggaggtggc

 1.28 Intr +  15735  15907  173  1  2   31   81   237 0.999  18.16
tgcccagcccggagtcatggggaaggtcctctgggcctcagggcaggcttgtgcctattt
ccattcggcccaggaaatccctcaaccaggtgcccccacccctgggagagctggcaagaa
acagggggcctggggaggtggcacctggggaggggtgacagctgtgggctcttggcacag
GGACCCCAATGCTGGAGGATGTAGATGAGGGGGGCATCCGGCCCTGGCACCTGGTGAAGC
CAAGTGATGAGCCGGAGCCGCCCAGGCCTCGGAGGGGCAGCCTTCGGGGCGGGGAGCGTG
AGCGCGCCAAGGCCATCCCTGAGATCTACCTGACCCGCCTGCTGTCCATGAAG
gtggggtggggcctgccaaggtagtggggcctgggctgagagggagcatggccactcgtg
ggatttgggggtggtgtggggctcgtgcaggcacagtgccggggggtgtctgaggctggg
ctgctgctgagggccctttgctgaccacacctctctgcttcttccttcccacagggcacc

 1.29 Intr +  16082  16242  161  1  2  142   75   313 0.988  35.38
atgaaggtggggtggggcctgccaaggtagtggggcctgggctgagagggagcatggcca
ctcgtgggatttgggggtggtgtggggctcgtgcaggcacagtgccggggggtgtctgag
gctgggctgctgctgagggccctttgctgaccacacctctctgcttcttccttcccacag
GGCACCCTGCAGAAGTTCGTGGATGACCTGTTCCAGGTGATTCTCAGCACCAGCCGCCCC
GTGCCGCTCGCTGTGAAGTACTTCTTTGACCTGCTGGATGAGCAGGCCCAGCAGCATGGC
ATCTCCGACCAGGACACCATCCACATCTGGAAGACCAACAG
gtggggtggagctgggtgggctctaggtgtgtgtggggggtcttctcttctgcctcccca
gcacattcatcggccatgcctgccccacccgcagcttgcctctgaggttctggatcaata
taataaaaaacccgcagtttgtgttcgacgtgcaaacatctgataacatggatgcggtgc

 1.30 Intr +  16304  16484  181  2  1   82   88   223 0.914  22.77
ctcagcaccagccgccccgtgccgctcgctgtgaagtacttctttgacctgctggatgag
caggcccagcagcatggcatctccgaccaggacaccatccacatctggaagaccaacagg
tggggtggagctgggtgggctctaggtgtgtgtggggggtcttctcttctgcctccccag
CACATTCATCGGCCATGCCTGCCCCACCCGCAGCTTGCCTCTGAGGTTCTGGATCAATAT
AATAAAAAACCCGCAGTTTGTGTTCGACGTGCAAACATCTGATAACATGGATGCGGTGCT
CCTTGTCATTGCACAGACCTTCATGGACGCCTGCACCCTGGCCGACCACAAGCTGGGCCG
G
gtgagcgagtctgggatggacacgggggggatgggtgagggtggacagtgctgtgtgtgc
actcagattccaggcttttctgagaacttcaaggagggcttaggggagacctctgacctc
ccaagccaaggcttcatcccggggccacctcagttttaagggatgagcaagaggagggga

 1.31 Intr +  18723  18787   65  2  2   95   79   127 0.688  11.16
aggaagtaggcgagggtgaccacctgtcctggttttccgggactcaggggcttcctggga
tgtgagacttttccttttcaaaactgaagcagtactgggaaacccaggacacttgatcac
tcgaacagggaccctcatccttccttccttcctcttttgctgtcctcctgctatgtccag
GACTCCCCGATCAACAAACTTCTGTATGCACGGGACATTCCCCGGTACAAGCGGATGGTG
GAAAG
gtactggagggcacggtgggtagaggttggagggcgtgtgcagctgaggcttggggggtg
ggctctggttgggagcaggggagtgggcttgtttacccagcagctgctgtgccctggctc
tctggcaggtactatgcagacatcagacagactgtcccagccagcgaccaagagatgaac

 1.32 Intr +  18916  18991   76  1  1   90   82    72 0.998   7.47
acaaacttctgtatgcacgggacattccccggtacaagcggatggtggaaaggtactgga
gggcacggtgggtagaggttggagggcgtgtgcagctgaggcttggggggtgggctctgg
ttgggagcaggggagtgggcttgtttacccagcagctgctgtgccctggctctctggcag
GTACTATGCAGACATCAGACAGACTGTCCCAGCCAGCGACCAAGAGATGAACTCTGTCCT
GGCTGAACTGTCCTGG
gtaaggcctccctctgcttcttgggttgggcataggcctcctgccacaacggtccttccc
ccttcacactgcccctttgcagggaagcccttgggaacctcagcagccctgtgagctggt
tggggcaggaaacataaatgcagaatgttccaactgccactgaaagaccagggctcccac

 1.33 Intr +  20016  20090   75  2  0  115   80   141 0.999  16.86
gcacacctggcctggggtccctgggccatggaggggactctgcttcccactgtagtgccc
atcccattctctacctctcaggtccccttctcccccagcccttccctggggtcctgggct
gcctcctgtggctctctgcacccctcgtctctctcacctttcatttggcctcttccctag
AACTACTCCGGAGACCTCGGGGCGCGAGTGGCCCTGCATGAACTCTACAAGTACATCAAC
AAGTACTATGACCAG
gtgggcaggccctggaccccgactgggaggctgacccaaggcctcccaggagacttaagg
ggctctgaccctgtgactcacgttgggggctttggtcttccccagggacagagtagtggg
gggccgggccccttggtggcttgagaagtgttttccaggcgggcttcctggcattggctg

 1.34 Intr +  20304  20375   72  2  0  105   54    35 0.854   2.55
acccaaggcctcccaggagacttaaggggctctgaccctgtgactcacgttgggggcttt
ggtcttccccagggacagagtagtggggggccgggccccttggtggcttgagaagtgttt
tccaggcgggcttcctggcattggctgtgctctcacctgtcccactgctccccattccag
CTCCCCAGCAGGACGGCGAGGCACAGTGCTGGTGGTTGTGGGGGCCAAGGGGTCTACCAG
GGCCTGGAGATG
gtgtgcatttgctgagttggcagcatgttgggcacggccaacatgcaagtgcaggcctgg
cttggctgcatgagctgcgaagaggagagtccaggcacagggccaggggtgtgagggtac
actggagctggtgaagctttttggaggatccctgggctgtgcctgaagagctgagcacct

 1.35 Intr +  21224  21313   90  1  0   80   37   162 0.332  11.65
gatgttattacccctcccgccagcgaggccctgaggtcccagaaagtacgtgaagtgacc
ggctgggtttcttggcctcctaccccactcatgccacagcgtcttaggagggctgttgaa
ttttgcagcaaacacgttggccaaagaagtctcccctgatggcattggtctctgtttcag
ATCATCACTGCCCTGGAGGAGGATGGCACGGCCCAGAAGATGCAGCTGGGCTATCGGCTC
CAGCAGATTGCAGCTGCTGTGGAAAACAAG
gtcacagatctataggaacccaggagccacggcctgctgttgcttcagcctggcctgggc
agccctggaagctcggaggagaggccaccttcttaggtgcctgtagtgactgacaagcag
agttagtggaaggtgactcccagtctcctggtggctctggcctcggccctgctggatcca

Predicted peptide sequence(s):


>PLXNB1_1|GENSCAN_predicted_peptide_1|2050_aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTTLVRPQC
CREEPVDYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQ
HLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPS
TATASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTD
FRPSATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKP
ALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDT
PGLWELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELE
GLEVVVEARVECEPPPDTQCHVTCQQHQVHTMSAWLSYEALQPELRVGLFLRRAGRLRVD
SAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACDGGTRVTIRGSNL
GQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLPCAYSLVCITGASGEEVAGATAVEVPGRG
RGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQPCHLLPE
QQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPTKSFLSGGRE
ICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHV
NSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPT
MPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHH
ALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVL
MYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYK
VYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTF
SARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTN
WMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPL
VRVCKCVACSLSATLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQ
RPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKH
VLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPE
IYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIW
KTNSTFIGHACPTRSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADH
KLGRDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGAR
VALHELYKYINKYYDQLPSRTARHSAGGCGGQGVYQGLEMIITALEEDGTAQKMQLGYRL
QQIAAAVENK