GENSCAN 1.0	Date run: 16-Jan-104	Time: 06:08:33

Sequence PLS1_1 : 92557 bp : 37.69% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +  17041  17144  104  0  2   66   89    75 0.535   5.16
gtgtggtagcagtacgttttcagaaacttcgtcgtatcatagcatggataggagggtgag
gagttcagggctgtcatttctcttaaaccagcttctgctgagactttgtgtagtccctgg
gtgtggttgtccctccctgctgacatctgaagtgtctgaatttccccttagtctgtaata
ATGAGGTCCTTGTGGGGTCCCTTCATTAAGACCCTGAATCCCCTTCAAATCCACTTGGTT
TTAGTAGTGGAATGGAAGAGGGAATGGGTTCGGATTGTCAAAGA
gtaagttataatttagctgttttaccccattacacttgagataacattgcttttctccaa
ttcctacttctcctttgaatactttctgtatcatttgaatatacggacacctcttcttca
tctcacctccttaattctctgtgtctagactgtaccagatggtgaattttattgattaca

 1.02 Term +  17383  17446   64  1  1   58   39   101 0.556  -1.42
aattcctacttctcctttgaatactttctgtatcatttgaatatacggacacctcttctt
catctcacctccttaattctctgtgtctagactgtaccagatggtgaattttattgatta
cacttatactaacattgctgtttagcttactaatttgtttttcttacatcccccaactag
TTTGAAAGCTCGTGGAATCTCTAGACCAGAAATTAAACTTCTTGATGCCCTTCGCAGTGC
TTAG
catatgactgagtgcacaggcagttcttagtaagtgttggctggatgaataaatgaatga
atttaaactttctaagtgtagagaataaatctaatatttttttctatatcccctatgatg
tttgacatagtgttaaacactaagcagtcataaactatttacttaattgaattgaattga

 2.01 Init +  38268  38352   85  2  1   93   97    46 0.664   7.04
tattttgtatacctaatctagtgaacgtcatagcttagccttgcataccttaaacatgct
tagaatgcttacagtatcctaaagttgggcaaaactttctgacaacgtggtaaatgtaga
gtattggttgttcacccttgtaatcgtatggctgaacgtggctcaccacctctgcccagc
ATGGTGAGAGTATCATACCGCTCTCTGCTGACTGTGTGTAACTTCCACACCATTGTGAAG
TTGAAAAATTCTAAGTCAAATCATC
gtaagttaggagctgtctgtatacaatcttgaagatccttttatatttttctgtttgttt
catttcaatgccaaaggattcaaagcaacatctttacacttattagctataaaaacaaag
ctttaaagataggaaacaacgttgtatgggtaaattgcttttttgataagtttacatggt

 2.02 Intr +  47089  47252  164  2  2   56   89   227 0.982  18.37
ttttaaaataaagcatatagcatattctgtacagttcaggtacaggaaaaaaggttactg
ccacctgtgaaacaaatgtgaaaggctctgtctgcacatctatgaatcctcccaaaaggc
atccttattgtacaccttcaacaaagattacaaaatatattttataatatatctttacag
ATATTGACAATAGTGGGTATGTCAGTGACTATGAACTTCAAGACCTGTTTAAGGAAGCAA
GCCTTCCTCTGCCTGGCTACAAGGTGCGCGAGATTGTGGAGAAAATTCTATCAGTTGCTG
ACAGCAACAAAGATGGCAAAATCAGTTTTGAAGAGTTTGTGTCA
gtaagtaatctaatcctttcgggctactgataatcttgcttagagcagaattgtagtaat
gtcatcactagctttggttaaatccagcttcagagaccagaaaaaggactgctttaaaat
gatgatgatgatgatgacaataactattattatcgaaataatttccacaactaattcata

 2.03 Intr +  48692  48821  130  1  1   86   93    81 0.960   7.75
tatttgtctattttgtgttattggtaaaatgatgaaagttatctgtgtatacaagcaata
agtacaactgactagtatttaatttggtgtcatttcaaataaagaagtgtaaataaatat
ccattttgtcaggtttttattgattatctgattctcaattttacttatgttccattccag
CTAATGCAAGAATTAAAAAGCAAAGATATCAGCAAAACATTCCGAAAAATAATTAACAAG
AGGGAAGGGATTACTGCTATTGGAGGAACTTCAACTATTTCCAGTGAGGGCACACAGCAT
TCTTATTCAG
gtaactgacttctccaaatttgatcttttagtcactgattcattgattaagtgacatatt
taatcagttctaagatgccactcattgtgattcataccgttattttatgtgccactgagg
agaaaaaaatactgcagaccacagtataacatgccattgaatttgaaatacatctcagtt

 2.04 Intr +  53856  53988  133  1  1   71   97   106 0.975   8.58
agccacctttcttcttttcttgaacccttttgtgttttagtagatttgtaataatggtca
attattatctttgagcagaaattaacaagtatgtttttgtagtgcaatagctatgtatgt
ttttatagtgcaataaagtttgtgaaatgagatttgcctaccaaggttttctcctttcag
AGGAAGAAAAAGTGGCTTTTGTTAACTGGATAAACAAAGCCCTGGAGAATGACCCTGACT
GTAAGCATCTTATACCCATGAATCCCAATGATGATAGTCTTTTCAAGTCACTTGCAGATG
GCATCCTTCTTTG
gtgagttgaacttctggttaaggaagctgcgttcttgctgattacattgatgagcattcc
atgaaaactccaattcagctgtccattgtcttttggagtcagtagctacttaggtcatga
ggaatttatattgcatagaaaatgaactactgtatatctattggaaaatttccaaaattt

 2.05 Intr +  55731  55812   82  0  1   88   84    69 0.993   5.22
tgggctcagcctcccaagtagctgagattatatgcatgtgccaccatgcctggcttactg
tttaatattttaaagtaatgaattgttattttcaaaatttatctattttggctgtttgca
ataataaactaaaaaaatttcttggagtattaaactaaattattctcattttctctttag
CAAAATGATCAACTTATCTGAACCAGATACAATTGATGAAAGAGCCATCAATAAGAAAAA
GCTCACGCCATTCACTATTTCT
gtaagtatttgccctttgcttattatcatgttactatgctgagaaatataagacctttat
taatgaatgcttggacccagataaaacctttgatttaattgtaatgctattctcctataa
aaacttttttttttggaatccttttttttatttttattttattttattattattatactt

 2.06 Intr +  61705  61870  166  0  1   59  116   120 0.969  10.51
ggcatataaagtaacagttaaaaccatgtgtttttttttttgagtagtggtattttcgtt
gtataaatattatgtttataaatctgaaatttggcagtccattgtttcttatagataatt
tttatagataagaccttagaaaggacttcctcatgtgtacttttttttttggcaattcag
GAAAATTTAAACCTAGCTCTGAATTCTGCCTCAGCCATTGGTTGTACAGTGGTCAACATT
GGTGCATCAGATCTCAAAGAAGGAAAACCTCACTTGGTCTTGGGACTTCTCTGGCAGATC
ATCAAAGTTGGCCTTTTTGCTGATATTGAGATTTCCAGGAATGAAG
gtaagatcattagaaatatttgctgttcattgacatgtacttgctatgggaagaatttac
atttcgctgttttgccctcagctctgattgcattgttaaatgaaggtgaggaactagagg
agctgatgaagctttctcccgaggaattactgctgcgatgggtgaactaccatctgacca

 2.07 Intr +  61952  62094  143  0  2   54   10   139 0.869   1.85
cagatctcaaagaaggaaaacctcacttggtcttgggacttctctggcagatcatcaaag
ttggcctttttgctgatattgagatttccaggaatgaaggtaagatcattagaaatattt
gctgttcattgacatgtacttgctatgggaagaatttacatttcgctgttttgccctcag
CTCTGATTGCATTGTTAAATGAAGGTGAGGAACTAGAGGAGCTGATGAAGCTTTCTCCCG
AGGAATTACTGCTGCGATGGGTGAACTACCATCTGACCAATGCAGGATGGCATACCATCA
GCAACTTCAGCCAAGACATTAAG
gtttatatttaaatgttcaaatttgtgacatgaaataaggatgtgcagtgtaaaaataaa
aggggttcagacttaaatttgaattaaattcacaagaacacttgggatagaaaatgaaaa
tttgcattactgtgtgaagtagatcccccaattatattcacaaaatatatattttctaaa

 2.08 Intr +  63983  64075   93  1  0   45   82    95 0.894   3.84
tgaagctctgaagtgtgaaacagcatggtacattcaggaacctacaagtaattctttatt
tttaaagttattccattctttgagatagaggcaatttcttcagtttgagcacttgttttc
cctaaattcaatgatgattttattcgttttaaaaatgctatttcatatctttccttgaag
GACTCGAGAGCCTATTTTCATCTGCTTAATCAGATTGCCCCTAAAGGTGGGGAAGATGGA
CCTGCCATTGCCATTGACCTTTCAGGAATTAAT
gtgagtgcaatttttaacttttaaaatatattgtggtaaaacagacgtagaaaatttacc
atttttatcattttcagtgttcagttcagtggcattcagtacatttgcattgttgtgcag
ctatcaccattatccatctctacaaacttttcatcatcctgtagggaaattctgtactca

 2.09 Intr +  67317  67512  196  2  1   75  100   219 0.996  19.87
ataaataaataaataaataaaggaatgggtaagttgacttggaattactacacattttga
tcttattttgagttattatttgatatatttgtggaaaagtaattgcttataaacatgtat
accaataaaaattatgccaattaaaacttcaattgtaaccatttttgttttattgtttag
GAGACAAATGACCTGAAGCGTGCTGGACTCATGCTTCAAGAAGCAGATAAACTGGGCTGC
AAACAGTTTGTTACTCCTGCAGATGTGGTTTCAGGCAATCCTAAACTTAATTTAGCTTTT
GTAGCTAATTTGTTTAACACATACCCGTGCCTGCACAAGCCGAATAATAATGACATCGAT
ATGAATTTACTGGAAG
gtgcgttctttctgcctttaattgacttgctatatttatcttcttatggtattgtcttac
ttcactgtcagagataggggattgtggtgggaaatgcaatttagtgtgtgtaggtatgtg
tatctattgaaaaattaaaattatggaaggtggttgctggttttggttaaaagagaatgc

 2.10 Intr +  70976  71129  154  0  1    7   76   163 0.892   5.21
agactgatcagttaccttttatgcagaccagagggaacaaaatttaagcaagaaattata
gggctacataatagagcaataattaaagcagattctgggaaagctgttagataatggcat
tgaaatcacatgaaactacagtgggtagatgatttcctgaacagttggcacaaataacag
AATCCTTTAGATCTGACAAGGCTTGCGTTCCTATCATGGGTGTGCAGGTTTATACTGTCT
TTGGCACTCAATGTGAAGATGACTGTTGCAATCGCTCTATACGAACGAGCCCCTGGAACG
CAGATGATTATAGATTTATGTGCCAAATTGTCCT
gtgagtctcacatgggccaaaatctagagagtgacttgaacttgcctataacttagaagt
gatgacaggtgtaaatgtttcagtttttcaggagtctgctgataagatgtaaactaggcc
attccactgtctaataactttgccgaagaacaaataatcatgatagttacttagaactat

 2.11 Intr +  75652  75766  115  1  1  103   63   145 0.970  13.03
taaacattttggacagattcttagactggaagttctgggtcaaatgatatgtcctgtcat
tctttaagaattaaatgacttatgttcttaaagatataagtctatctccagtgtacttaa
taaaattaggtaatacccaacatttcctcctcctttatctgcttttccttcctgcttcag
TGACCTTGCAGATGCTTTAGTGATCTTTCAGCTCTATGAGATGATCCGAGTGCCAGTCAA
CTGGAGCCATGTCAACAAACCTCCTTATCCTGCCCTTGGAGGGAACATGAAGAAG
gtgaatgaaataatggccatggatatattgttattgttctgatatgaaacaaagaattta
gagtttcatgaagttatacgtgctctgtccccacaattctgattcagaccaaaatgtgtt
aagcttaatagcctttttacaagtttgctttaataaatttgaagatgaaggcaatccctc

 2.12 Intr +  81567  81700  134  2  2   60   98    79 0.997   4.62
tcttcaactataaaatggaaataattatgtccttgctttccctgggttattattatgaaa
ttggtcatataaatttaaggtgtcatcataattgtttttcagatggctgaactaggctgg
cctattctggagatatgtttttaaaaatctttttatacccaaacttttacttatttatag
ATTGAAAACTGTAACTATGCAGTGGAACTTGGGAAGAACAAGGCCAAATTCTCCTTGGTT
GGCATTGCTGGGCAGGACCTAAATGAAGGGAATTCAACACTTACCCTGGCATTGGTATGG
CAGCTGATGAGAAG
gtaaaggctgatatgttggtagcaacactgcctgtttcctccaacaagtaatctgaacca
aatttttagctatttttgaacaataatgaacacagaagaaatatacaatgcaaaatattt
taatttttaaaggatttactgttgattatggtttttttgtaaattatattttatttaaaa

 2.13 Intr +  82162  82285  124  1  1  114   84    92 0.995  11.07
tgtttctgattaatgaggtttgtaactttggaatgtaactgggtgcaaatgccagactaa
aattagaaatatttattagaactgaactatttcttaagtatttatctaaacattgatata
aattatgtgaaagcaaatttcacccttttcagtctcaaatatacatcttttctgttgcag
GTACACATTGAATGTGTTATCGGATCTTGGAGAGGGTGAAAAAGTAAATGATGAAATTAT
AATTAAATGGGTCAATCAGACTCTTAAAAGTGCAAACAAAAAGACTTCTATTTCCAGCTT
CAAG
gtaatcaagagtcctaaaaaaaatttttttttgtaggtataggaaggaattttttttttt
tttttttttttttttttttggagatggagtctcgctctgtcacccaggctggtgtgcagt
ggcgcgatcttggctcactgcaagctctgcctcccaggttcacaccattctcctgcctca

 2.14 Intr +  89200  89324  125  0  2  100   71   138 0.999  11.76
ttcaaggaaaagtatattttaaagggtttatttatgtgtgctggttgcagaaaagctgaa
cgttaggttaagtacaaagaatttgtagattgccttcagttatatgatcagaagagtctg
aaaataatgaaaattaaaggtcagatgtttatgaatgttcatctatgctttattttctag
GATAAATCTATAAGCACAAGTTTACCTGTCCTAGATTTAATAGATGCCATTGCACCAAAT
GCAGTTCGTCAAGAAATGATCAGGAGAGAAAACTTATCTGATGAGGACAAGCTGAACAAT
GCTAA
gtaagcctttatggtttatattacaatacatggccctttaattctctaaaatccttatag
gaaaagttactatgcccttaaaattcatatttttaaatataacttatatgtgagtcttag
atttaagactcacaaacttaaccttttcgtaaaactaatcttgtcaaaatatttcactct

 2.15 Term +  89571  89706  136  0  1   62   37   198 0.999   8.61
ttactatgcccttaaaattcatatttttaaatataacttatatgtgagtcttagatttaa
gactcacaaacttaaccttttcgtaaaactaatcttgtcaaaatatttcactcttttgtt
aaaatatgttaagtgaaaacacagtggataacaccaagatatttttcttgtctcttcaag
ATACGCCATTTCAGTTGCTCGAAAGATCGGTGCCCGGATATATGCATTACCTGATGACCT
CGTAGAAGTGAAACCAAAGATGGTTATGACGGTGTTTGCATGCTTAATGGGAAAAGGACT
GAACAGAATAAAATAA
tcatttcatatgattttctgccacattaaacatattgtatgcctcacagtttacaggatt
ctgaaatgtagtgggtgtaaaaccagagattatttgtatgctcaaaatagttatatattc
attaatgaattcaatatcctgttcatactagttagagctggtcagcctttttgggtaaca

Predicted peptide sequence(s):


>PLS1_1|GENSCAN_predicted_peptide_1|55_aa
MRSLWGPFIKTLNPLQIHLVLVVEWKREWVRIVKDLKARGISRPEIKLLDALRSA

>PLS1_1|GENSCAN_predicted_peptide_2|659_aa
MVRVSYRSLLTVCNFHTIVKLKNSKSNHHIDNSGYVSDYELQDLFKEASLPLPGYKVREI
VEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEG
TQHSYSEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPD
TIDERAINKKKLTPFTISENLNLALNSASAIGCTVVNIGASDLKEGKPHLVLGLLWQIIK
VGLFADIEISRNEALIALLNEGEELEELMKLSPEELLLRWVNYHLTNAGWHTISNFSQDI
KDSRAYFHLLNQIAPKGGEDGPAIAIDLSGINETNDLKRAGLMLQEADKLGCKQFVTPAD
VVSGNPKLNLAFVANLFNTYPCLHKPNNNDIDMNLLEESFRSDKACVPIMGVQVYTVFGT
QCEDDCCNRSIRTSPWNADDYRFMCQIVLDLADALVIFQLYEMIRVPVNWSHVNKPPYPA
LGGNMKKIENCNYAVELGKNKAKFSLVGIAGQDLNEGNSTLTLALVWQLMRRYTLNVLSD
LGEGEKVNDEIIIKWVNQTLKSANKKTSISSFKDKSISTSLPVLDLIDAIAPNAVRQEMI
RRENLSDEDKLNNAKYAISVARKIGARIYALPDDLVEVKPKMVMTVFACLMGKGLNRIK