GENSCAN 1.0	Date run: 16-Jan-104	Time: 06:09:23

Sequence PCOLCE2_1 : 73622 bp : 40.98% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1397   1479   83  1  2   88   82   237 0.999  21.59
ccggctacctgggccgccccgcggcggtgcgcgcgtgagagggagcgcgcgggcagccga
gcgccggtgtgagccagcgctgctgccagtgtgagcggcggtgtgagcgcggtgggtgcg
gaggggcgtgtgtgccggcgcgcgcgccgtggggtgcaaaccccgagcgtctacgctgcc
ATGAGGGGCGCGAACGCCTGGGCGCCACTCTGCCTGCTGCTGGCTGCCGCCACCCAGCTC
TCGCGGCAGCAGTCCCCAGAGAG
gtaacgcgacccctgcccgggctccctttctctcctttcccttcctccacccctgcagcc
tcgcctgctgctttactcaacccgcttcggcgcgcctgggtgacccagcgctcgaccctg
cgctcccgcgcggtgcaggcgtccgccaccctcgggtaggctaagcccgggacttcggga

 1.02 Intr +   2516   2624  109  2  1  100   72    68 0.975   5.77
caggctataatttaaatattctaggagctagcaaattttcagatcccttatatggtgcaa
gcattgattaatcaacattaacttttatttatattaataggctacacctttctgaaggta
acatcagattgttagaccatgtttcaaattacattatcttttcttcttttatgttcccag
ACCTGTTTTCACATGTGGTGGCATTCTTACTGGAGAGTCTGGATTTATTGGCAGTGAAGG
TTTTCCTGGAGTGTACCCTCCAAATAGCAAATGTACTTGGAAAATCACA
gtaagcattttttaaaaaggtattctcctggaagtgggtgttggcaacagtgtgaggctg
ctgcctttttcctctggtgttaggatttgagtaagaggcaaatgcctgaaatagtgaaat
gttggatttaccccaactattgggaagatttttattaatataatagatctagtcgtgtcc

 1.03 Term +   8230   8340  111  0  0   10   44   205 0.973   5.88
tgaacaacgtaaagagaccctgtctctgcaatttttttttttttaaattagccaggagtg
gttgtatgcatctgtagtcctcgctacttgggtggctgagatgagaggatctcttgagcc
caggagtcagagggtgcagtgagctatgattgtgccactgcactccagcctgggtgacag
AGCAAGACCCTGTCTGATGATGATGATGATGACGACGATGATGATGATGTGGGAGGGCCA
GAGAGTCACAGACCTTTGACAGAAATGGGAGGAGAATGTGGCAATGGGTAG
aggcagtcccattaaagtgaaaagtatgtggcaaaatttttcttatttagctactccatg
aagaaaaaagcgtaagttgtcttacatagaaagatcttcagattctccaggtaactcaag
tattaccatctttataattacatctgtttttctgttcagctagagtgaaatacagtcaca

 2.01 Init +  12532  12637  106  0  1   95   77    74 0.663   7.43
cattcattcattcattaaaactgtaaagtacctaccagagatcaggtgctggattgggca
cagaaacagcaataattgaaaaatcacattcctgaatggggctgggcgaggtaaggaggc
tcttactcattggggagatgtcccagaaacaatgaacagtggcacagggtgacagggacc
ATGGTTCAGGGTAGTACGTGTGATACTGCTCAGTTACTAGAAGAATGGGCATTGGAGAGT
CAGACTGACATAGTTCAAATCCCTGTTCAGCCATTTAATTTACTAG
gtatgtgattaagtttctgggactttctaaagttagtatcctggatataatggtcaaaca
tgccttgtaaggttaatctgaagactgaaggaggcagtagatgaaagtcccttagcacag
tgcttggcacaagcaggcactcaataaatggtagtgttgctttatttatttattttttaa

 2.02 Intr +  13254  13351   98  1  2   52  105    -6 0.021  -3.69
ggcattccataaccgttaagacttttcaaagtagagaaaagattgtcagttaaaaattgc
aaataattttctctgtttatagatggagactttaatttacctttggagtcccaaatcatc
agaataggccccactaattacataaattaagtaaagactgtattcatttattcctaatag
AGACACAACATGATATGGTGGTTAAGAGTGTATTTTCTAAGAGTGTAATTTCTGGAGCCA
GACAGCCTGGTTCAAATGCTAGTTCCACTGTTGTGCTG
gtgagtctccaaagatgacctccccaatcaccacacctcctggtattcatgcctttttct
ggcatcccccagcattgaatctgggcttgcttttggaacaaattggatggagcagaggtg
acattgcatgacttctggggcaagaacataagaagctgccatataaggcccaccatgctg

 2.03 Intr +  28177  28275   99  0  0  108   53    77 0.358   5.59
ctagaaaggctctggagctggaggcacctggtttcttggaaggcaggagggcagatgagg
ttagaagttggagttctgtttgaaggcctctgtaagagcggttaaccctacaggttccct
cctccacctccagcagcaagggtgctgtctctcttctacctccccaccttctccctccag
CCTGGCAGGGAGTATGCTCTGGGAACCACAGGGGTTCTGGGCTTCAGAACTGCAAGCCTA
GCAGAAGAGGTCAGGCCCAGGTGTGGCACTGAAAACAGG
gtaattacagtctgtgtactagaatggtgagaccccggccccacctctttccctgctcct
ccgatgaaagctgcagcaaggtctttacacctcaggcgaggcatggaacaatcttagaga
aaatgaacagcccttgagaaaggacctctatccagatactgacatttgggaggcccaagg

 2.04 Intr +  32042  32150  109  1  1   31   52   129 0.896   2.54
taaatagcaaagaaaatcccgaaactattcacagatctgagaccaaaatatatgaagata
ggaaactttttttccatctccatcttcacctgcattgtgctttttggatgcctggctgcc
aggtgcatgtgggttcaattactcagacaaagatgactagaacactcctgtctgtgcaag
GTTCACAGTCAGCTGCAAGGCCAGGTGCACACTGCAGACACCTGTGAGACCTGTGGATGC
CGAGGAGGCACCAAAGGGGAGAGGGAACAGTGGGCTCTGGCTCTGGGAG
gtgaaagagggaagataacatccccccaggtctaggaattggatgggagaggatgagttc
ctcgagaaggtgtatttggccccaactttgaaattggagtggaagtcaatagtctgggaa
gggaagaaagaatattccaggcagggaatttacatacgacctcacagaggtgggaaagga

 2.05 Intr +  33056  33127   72  0  0   67   95   109 0.707   7.96
tgcccggagttctccttgaacacatggctaaatgtgaaagacaaccagtgataacctgtc
tctcctttccaaaccctttcctgacacaactaacagctttcaaggacagcaggcaggaca
cacactgatcacatgaaacagcttgggcttcagccactaggtgctatttactccttccag
TCTCCAAGCATTTGCTGCTGCTGCTCCTCGCAGCCACAGGAGGTGCCAGTGCTGTGGTTG
ATGCCAGACCTG
gtaaggcacccgaagcaccaggctcgcaccagctggttcagtaggaagcatgggaaagta
caggttcattgcacacatacgatagattgggaaatggagactcttacttactatagagta
tatagaatatcctggatgctcttgcctagagtgtttctgaaatttattgctccgtgtgta

 2.06 Intr +  33668  33936  269  0  2   61  103   160 0.702  11.13
ccaccacttatgtccacagtaggatctcagggtatcactggccaaaggaaaactgcaaga
caaatgtctgtgaaaaggaatactcttcgttttcaacgttatctctttccccagccaaaa
cctaatgcgacagctcttggcacgattgcctgtctcctcatcctgctgcatctaccttag
CCTTCCTGCTTCTGTGGGTTCGGCTTTGTTGTCCCTTCACGTTTTTCCCATTTGCCTTTC
CACTTGGCAGACTTCAGTCTGAACACCCTCCCAATGCCGAAGGGCCTGTTCGCAGCTGGG
ATCTTTCGAACATCTTCATGCTTAGGCAGCATTTGCACAAGAGGCATAACCTGAAGTCCT
GTCTTGTTCGTTTTGTAGCCAAGTCTTCATTCAGCTTAAGAAGTACTAGTGGCTGCTGGT
TGCCTCTCACCCCAACTGACCAGCCACAG
gtaaaggactcagcggtgataactcagaggtgataacaggggctcgagggcctagttaca
cttttgcagaggccatggaaattacagtatgtgcctcgatgattctgaattttctcccct
ttgtggttgctccaaatcatctacgtctactcgaaagtgaggtgctttgacctgaattca

 2.07 Intr +  35851  36024  174  0  0   95   76   108 0.932   9.51
ttttttagtgaaatccccaaaaacaaaagaaaatgttcaaaacatctcgttatttctaca
atcaaaatatgttttattttttaaacatgtataagatttacctttacaagagtagtattg
aaatatacccagaatatagatgaataagatcttgtaagcttctgatttatccccctctag
AAAGACTGCCAAATATTTTTACATAATTTGTCTATAGATCTTTCTGGACTACCTTTGGAG
GTCCATGGGAGAGGTGACACTGAGTGGTCACCTCGAGCTTTACGTAGATCAACTGTGCCT
CGAGCTTTACGTAGATCAACTGTGGTCTGCATTTTAGAATGCACGTTCCCAAAG
gtttgtttgtggaagagggaaatcgtagaagattagaatgatggcttaaaaaaaaatcac
gtgctgcaaaaacagttctttttgatcaaagtagtaaatgatgtgtttagggaggaaaag
ctgcagacacaaaggagcattcccatttctgcagaaatgcactcctccacacagaagaag

 2.08 Term +  41821  42093  273  0  0   95   39   377 0.771  27.99
gtacttaaattttttaggaatgcaatatgctagaaaacttcccttgggttagttcagata
tgagagaggaaaaagcattatcttggatattatactttacacacttaagtaagtgactag
atgtcaaagcctcagatattgttttcatgacagttttctaattggcgcttttcttggcag
GTTCCCGAAGGAAAAGTAGTCGTTCTCAATTTCCGATTCATAGACCTCGAGAGTGACAAC
CTGTGCCGCTATGACTTTGTGGATGTGTACAATGGCCATGCCAATGGCCAGCGCATTGGC
CGCTTCTGTGGCACTTTCCGGCCTGGAGCCCTTGTGTCCAGTGGCAACAAGATGATGGTG
CAGATGATTTCTGATGCCAACACAGCTGGCAATGGCTTCATGGCCATGTTCTCCGCTGCT
GAACCAAACGAAAGAGGTACTGTTTCCACATAA
tggcaataacaacagtaatgttggttcactgttcttggcacttgatgtttatttactcct
ttaaagcttaagagtggttctcaaagagctagtgaatgccatcaaaccatgatgagacca
atacaaaaaatcagccttttaatttaagtccacatgcattcttgtaaatcaagtatagaa

 3.01 Init +  45483  45557   75  2  0   59  100    63 0.554   5.74
gattgaaaagccagacccaactatatgttgtctacaagaaagcacttgaaatacaaagac
caagttggttgaaagtaaaaggaaaaatacaaaacttcattaaaattaaaactaatactt
ataaaaagacatggttacaaatacaaatagcctacagaaggggagaaaatattcacaaaa
ATGTCTGGTGAAGAACTTGTATTCAGAATATACAAAGAACTCATACAACTCAACGATAAA
AAGGTAAAGATTCCA
gtaagtataaaaattggcaaaacacttggacacttcacagaggaaaatatgaatggccaa
taagtgcatgaaaaactactcagtatctctcattagtcatcagggaaatgcaaattaaaa
ttacagtgagatgccattacttacccaccatgttggctagaaaaactgacaccaccaagt

 3.02 Intr +  51387  51523  137  2  2   51   85   167 0.966  11.15
agaataccacagttttttttttaactaaataagaaatatgcaacaaaaagcacttaatgc
atactttttttacaaaggaaaatcgtagtatcctccaaatctggggagaggaagaattcc
atttgaggttattcaacaatgctattaatatttgacacttctattgtgctttctctaaag
CTTATAGAATTAAAGTTTGAGAAGTTTGATGTGGAGCGAGATAACTACTGCCGATATGAT
TATGTGGCTGTGTTTAATGGCGGGGAAGTCAACGATGCTAGAAGAATTGGAAAGTATTGT
GGTGATAGTCCACCTGC
gtaagtagcacctatttatgtctttaatagttttatggctctaaacttgtttcttgttca
gtttcccaatcacatttgttttctggaagattttatgttgttgttgttttgttaaattat
tgggtcctctattagttctcgcactgctgtaaagaaatacctgagactgggtaatttatt

 3.03 Intr +  60447  60601  155  0  2   84  114    81 0.955   9.09
gctgagcaaacactcggtaaatgttagctattagaattggtatttttaaacgttttaact
tttaagtttaaacaactggtaatctattgtcggaagttaatggaaaactagaaaatttta
cattttcagagaggcaccacttttaagtatttataaaaaaacacatttttctttttttag
GCCAATTGTGTCTGAGAGAAATGAACTTCTTATTCAGTTTTTATCAGACTTAAGTTTAAC
TGCAGATGGGTTTATTGGTCACTACATATTCAGGCCAAAAAAACTGCCTACAACTACAGA
ACAGCCTGTCACCACCACATTCCCTGTAACCACGG
gtaagttttcctgtttggaagtttgtgcaaaaactttaggagtataagaagaattctttt
aaagtagaaaaaaaataagaggaagatacttgaaattaaagttaaataggatgaaagctt
tggtaagagaataatatgactgcattaatgaaagaaaggtatggggtgtaagaatgcttg

 3.04 Term +  62558  63243  686  0  2  -23   48   569 0.744  34.60
cagctagggggatactgccactgttcacagaggtagagaactggattcggaggtggattt
ataaattaggctgtcgccttgttgggtttgaggtgtccgtgagattttccagtggatatg
ccatgcgtaggggtacacgggtccccagactaaaagatttaagccagatttaaatttaag
AGTCACCCATCATCCACAACTCGGGTCACAGCGCGCCCCTCCCCAAGGTGGTCTTCCGCG
ACCCGTACTGGTTTAAGAAGCGGACGGAGCTTTTCATTGCTGCCGAGGGCATTCACACGG
GCCAGTTTGTGTATTGCGGCAAGAAGGCCCAGCTCAACATTGGCAGTGTGCTCCCTGTGG
GCACCATGCCTGAGGGTATGATCGTGTGCTGCCTGGAGGAGAAGCCTGGAGGCCGTAGCA
AGCTGTCCTGGGCATCAGGGAACTATGCCACTGCTATCTCCCACAACCCTGAGACCAAGA
AGACCCGTGTGAAGCTGCCCTCTGGCTCCAAGAAGGTTGTCTCCTCAGCCAACAGAGCTG
TGGTTGGTGTGGTGGCTGGAGGTGGCCGAACTGACAAACCCATCTTGAAGGCTTGCCAAG
CCTACCACAAATATAAGGCAAAGAGGAACTGGTGGCCACGAGTATGGGATGTGGCCATGA
ACCCTATGGAGCATCCTTTTGGAGGTGGCAACCACCAGCACATCGGCATCCCCTCCGCCA
TCTCAGAGATGACCCTGCTGGCTGCAAAATGGGTCTCATTGCTGCCCGCCAGACTGGACG
TCTCTGGGGAACCAAGACTGTGCAGGAGAAAGAGAACTAGTGCTAAGGGGCTCAATAAAG
TTTGTCTTTATGCCAAAAAAAAGTAA
gagtcatcaatatatagatagttgaaacaatgatcaagaacgagatgacctaggcagaga
ttgagggcaggaggaggagaggcgcggagattaaccctctagaaacttccgtctttttga
agagaaggttacactggcaaaggtgactgaaaagcagtggcgagggaggagggaggagaa

 4.01 Init +  64739  64904  166  1  1   62   59   238 0.440  18.14
atagaattgctaaggaagtaaagacaggccagggctgacgggttgggaaaaatgagagca
gccaatatattgaaccatcaaagatggaagaaaacatagtcatagagtgattaaataaat
aagcttggaggggagaacgctgtcctggttgccagcaggtctaaatttgatagactggca
ATGAACAGCCATAGCATGAAGACATCCGAGCCTGGAACTGAGTGTCTAGGAAAGTCCCTG
GTGAAGATGAGGCCACGGGGACTGCGGGATCAGACATGGGAGGGTGGACCCATAGAAACG
ATCGCGGGAACACAGCCAGGGAGGGCTGAGAACCGGGACCAGCTTT
gtgagtgaagggcaaggagacagatgacagttaagatgaggaggggaaggagagagccag
tgacttgcaggccagacagcaggccccaccaaagcaggagaagggcatgttggacaccca
ccccacttccagactgaccttcggaggctgagaagcagccggttcccaatgggcccggga

 4.02 Intr +  69248  69415  168  0  0   79  105   101 0.902   9.90
cagctccaacctgaattttggtgacaaatgtacagaagcaaatgtgaaacctctatgagg
gccttttctttaacattaaaatgtttcgtatctgaaacttagaagaatgtaaacttgttt
ttcagttctgcttgcatttgccttcactgtcacatcacttcaaaatgttttcttctgcag
TATTAGCCGGCACTGTTATCACAACCATCACTCGCGATGGGAGTTTGCACGCCACAGTCT
CGATCATCAACATCTACAAAGAGGGAAATTTGGCGATTCAGCAGGCGGGCAAGAACATGA
GTGCCAGGCTGACTGTCGTCTGCAAGCAGTGCCCTCTCCTCAGAAGAG
gtgagtagggagaaaactgggtgtctctgagcaagccatggattttccatgccatggttg
gtctagggaagtaaaatcagggctaatatgttgcccacttcttgcagagcaggaaggcct
ttggagtcaggcagaattgggctctcatccaagtccttgtaacttgtggcagaagaaggg

 4.03 Term +  71828  71958  131  0  2   99   42    58 0.633  -0.34
ggcaagacccccatctctaaaaagcaaaaacaagaaacccagattttatcgtggatggaa
tacatgtataatcttaccatttgcagaagagaacatttatctagaggtaacttacagtct
aagttgtttcacacatgatacatagagaaaaagattaatttctgtattctctttctttag
GTCTAAATTACATTATTATGGGCCAAGTAGGTGAAGATGGGCGAGGCAAAATCATGCCAA
ACAGCTTTATCATGATGTTCAAGACCAAGAATCAGAAGCTCCTGGATGCCTTAAAAAATA
AGCAATGTTAA
cagtgaactgtgtccatttaagctgtattctgccattgcctttgaaagatctatgttctc
tcagtagaaaaaaaaatacttataaaattacatattctgaaagaggattccgaaagatgg
gactggttgactcttcacatgatggaggtatgaggcctccgagatagctgagggaagttc

Predicted peptide sequence(s):


>PCOLCE2_1|GENSCAN_predicted_peptide_1|100_aa
MRGANAWAPLCLLLAAATQLSRQQSPERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCT
WKITSKTLSDDDDDDDDDDDVGGPESHRPLTEMGGECGNG

>PCOLCE2_1|GENSCAN_predicted_peptide_2|399_aa
MVQGSTCDTAQLLEEWALESQTDIVQIPVQPFNLLETQHDMVVKSVFSKSVISGARQPGS
NASSTVVLPGREYALGTTGVLGFRTASLAEEVRPRCGTENRVHSQLQGQVHTADTCETCG
CRGGTKGEREQWALALGVSKHLLLLLLAATGGASAVVDARPAFLLLWVRLCCPFTFFPFA
FPLGRLQSEHPPNAEGPVRSWDLSNIFMLRQHLHKRHNLKSCLVRFVAKSSFSLRSTSGC
WLPLTPTDQPQKDCQIFLHNLSIDLSGLPLEVHGRGDTEWSPRALRRSTVPRALRRSTVV
CILECTFPKVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGAL
VSSGNKMMVQMISDANTAGNGFMAMFSAAEPNERGTVST

>PCOLCE2_1|GENSCAN_predicted_peptide_3|350_aa
MSGEELVFRIYKELIQLNDKKVKIPLIELKFEKFDVERDNYCRYDYVAVFNGGEVNDARR
IGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYIFRPKKLPTTTEQPVTTTFPV
TTESPIIHNSGHSAPLPKVVFRDPYWFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGSVL
PVGTMPEGMIVCCLEEKPGGRSKLSWASGNYATAISHNPETKKTRVKLPSGSKKVVSSAN
RAVVGVVAGGGRTDKPILKACQAYHKYKAKRNWWPRVWDVAMNPMEHPFGGGNHQHIGIP
SAISEMTLLAAKWVSLLPARLDVSGEPRLCRRKRTSAKGLNKVCLYAKKK

>PCOLCE2_1|GENSCAN_predicted_peptide_4|154_aa
MNSHSMKTSEPGTECLGKSLVKMRPRGLRDQTWEGGPIETIAGTQPGRAENRDQLLLAGT
VITTITRDGSLHATVSIINIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRGLNYIIMGQ
VGEDGRGKIMPNSFIMMFKTKNQKLLDALKNKQC