GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:00:49

Sequence NME6_1 : 9187 bp : 48.14% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   4040   4129   90  1  0   71   94    58 0.663   3.29
gagcccaaatgggcaattaaaataatgtatatggccttaagatgaaactgtcaggttctt
tatgagtgtcaggagtgagagcactcgttggcttgcaaggctgcgtggctccaatgtagg
gaaggctgggagtgccgtcctgaagggttcctaatacagctctctaatggcaggagtgag
ATGGCCTCAATCTTGCGAAGCCCTCAGGCTCTCCAGCTCACTCTAGCCCTGATCAAGCCT
GACGCAGTCGCCCATCCACTGATTCTGGAG
gtaagaatgaatcctaagtctctaccgcatgccctgggaattgctactgcttcaggtgcc
attgggccatttatggtgactgacaacacagacttgtgctggatgctgtggaggcaaagc
tagaagccatgaactctgacctaaggagactaagaatccattggagacttgaggcagacc

 1.02 Intr +   5727   5829  103  2  1   39   97    98 0.689   5.55
tttcacccaaggtgcacactctggctgtgtgactgaaggtcttcacctcaccccacctcg
tcttctcacccttcaatgggacaaaccctcaggtcctgagcaacaagtggtcctcatggt
ttcttttggtcagtttcagtctcctgattgatttttattttggggatggtctttattcag
GCTGTTCATCAGCAGATTCTAAGCAACAAGTTCCTGATTGTACGAATGAGAGAACTACTG
TGGAGAAAGGAAGATTGCCAGAGGTTTTACCGAGAGCATGAAG
gtaggatcagtagtcctctgaatggaaggtgcctcaatcccaagaggccataagagagat
tttacctggaacacaatggcaggctctctgacctaccaaccgtgtacagttgcagccagt
tttctaaaatcttggtttaaaacacacacttttcatgattatccatcttttcccaaggag

 1.03 Intr +   6398   6437   40  0  1   99   80     6 0.879  -1.82
aaaactacgcaggttgtaagtggcagaccctggattcagacccaggtttgtcagactcca
aggtccttgttcttttctctgaaacaatttttattattctaggtaaggaggtagaagtac
agaaagttgccttgggcaccaggatgaaggtatcttgatgaaggtcctctctctttgcag
GGCGTTTTTTCTATCAGAGGCTGGTGGAGTTCATGGCCAG
gtacttcaaatttggttccagcatctttatccactgaggctaatctcccctgcccctaaa
tggatttgttcatttcactgccattctttaaagttgtaatcaggccaggcacggtggctc
atgcctgtaatcccagcactttgggaggctgaggcgggtggatcacttgaggtcaggagt

 1.04 Intr +   7321   7481  161  1  2   88  100   201 0.995  20.93
gcaggcttgatgtacaccagcaggggccctgcatcacctatttgaagcagcattggtact
cagctggaaaggcaggaaaactctcagaacgtagagtgtgtttttattcaggccctgctc
acagcacaccctcctagtctagatggccaggttctttacatgtgcttgttttgttcacag
CGGGCCAATCCGAGCCTACATCCTTGCCCACAAGGATGCCATCCAGCTCTGGAGGACGCT
CATGGGACCCACCAGAGTGTTCCGAGCACGCCATGTGGCCCCAGATTCTATCCGTGGGAG
TTTCGGCCTCACTGACACCCGCAACACCACCCATGGTTCGG
gtgagtcccctgtccatagccataggatattttggggttagcgggcaggctgtgtggtag
agttgacagccaggtccctccagtgagctttcttccatttgtgtttctggtctttgtagc
catgttggcagatgtggcctgtggactttctttacatgccccaggactgaaggggcaggc

 1.05 Intr +   7753   7875  123  2  0  112   22   123 0.188   8.66
cttccatttgtgtttctggtctttgtagccatgttggcagatgtggcctgtggactttct
ttacatgccccaggactgaaggggcaggcagagtagaggctcaggattctgaacctgatt
atgactgcctcttgcttctaccatgtgagaaccccttctctgtcttatctccccttacag
ACTCTGTGGTTTCAGCCAGCAGAGAGATTGCAGCCTTCTTCCCTGACTTCAGTGAACAGC
GCTGGTATGAGGAGGAAGAGCCCCAGTTGCGCTGTGGCCCTGTGTGCTATAGCCCAGAGG
GAG
gtgtccactatgtagctggaacaggaggcctaggaccagcctgatgcaggtctatgaaga
ccagtggtagtgcccagacttctcctagacatctagtctaaaacattctcctaggaccag
ggaagcctggcttacagtgccatttctgctgggcaccaccacctgcctgagggcctagct

Predicted peptide sequence(s):


>NME6_1|GENSCAN_predicted_peptide_1|173_aa
MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFY
REHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGX