GENSCAN 1.0	Date run: 16-Jan-104	Time: 07:06:05

Sequence LMCD1_1 : 68694 bp : 44.10% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   1218   1356  139  0  1    8  113   105 0.363   5.47
cagctccgctcgctgccacagtgcagagacctccctgagggagggggacagcctcgcgct
gggattggctggcctcgcgcgagcgccggcgcggagtggctggcgaggttttagagggag
tcccgctctccaattaaagcggcccagctgcgcctggctgcgcacagagctccctcccag
GCCCGCGAACTTGGCCATTCAGCCGCCGCTGTCCCCGCTGCGCGCCCTCGCGCCTCTGCC
TGAGAAGCCAGGCGCTGTTCCCCCACCCCAGAAGAGGATGGCAAAGGTGGCTAAGGACCT
CAACCCAGGAGTTAAAAAG
gtgagtggaaagctgtttgtatttacccagattcttactttttcttgttccccttcccat
ctgttcgcggaaacttcccaaaaggtaatgagaagggaactctttaaattccaaaactgc
atggaaaacaaatagttgggaatacatgtttgagctaacaggcacacacaccccaaaccc

 1.02 Intr +   6269   6551  283  1  1   89   62    98 0.376   4.29
accatttaaatctttattttaagaacagatttctggcaggggcgtgagtcattataataa
ctgcaggcgtttactcactgggtgactttggataggtcacctttcctaggaagtggcaga
atttggatgagaaccagggttccttctgcctccagcccactgacttttcctttacaccag
ATCATCTCCCAAATAACAAATGATTATGACAAAATAGGCTTAAAACTTCGTTCCACTGAA
AGCGGAATTGTGGAGCAGCTTTTCAGGACATCCAAAATGAAGAGACAGCTGTTGCTCTTG
AAGAGCCTTCGTTTAGAAATATCCTCATATCCCCTACCATTTGATAACAGGAAGAGGATT
TGGCCAGCAGCTGCTACTGTCTCACCAGGTGCAGGGCCACCAGCCACTTTTGCAGGACTC
CTTCAAGAGCACAACATTTCCTTAAATCCACGTGGAACAATTG
gtgtgtcccaaaccattgttggatgtttacatatagcaatagcatagatctgcaaaagct
ctagaaaatgctctctataaaacttttatagaaagagttacatatgaagttgagtctcct
gtgttcaccaaggctcctttagtggctgaaacacaaatttagtatctaatcctgtatatt

 1.03 Intr +  32113  32201   89  2  2  103   77    75 0.154   7.59
attccatgttcctgtttggtcttctcagttcccggtaaacagtttgtgatggcttattga
tctcaagccctttgaaccccacacagtccctttgccagcacgccaagtcttttagaggtc
aagcatctccggtccaagatgtttggaaggaaaacaccctcttttctgttccttttccag
ATGTCCCTGGGCCAGCTGCAGTCAGCAAGAGGTGTGGCATGTTTGGGATGCAAGGGGACG
TGTTCGGGCTTCGAGCCACATTCATGGAG
gtaacagattttgtcaggagggtccctgtctgcctttgttacttggctgtcctctcgggg
aaccctggttgctttcttcgctgagactgctttggttgtatgcgttgtcagggaaggatg
gctgcagagggaaggcactcctgcttggtccaattcagaaacgaaaaaagtccttggggg

 1.04 Intr +  32680  32846  167  0  2   56   93   -24 0.226  -6.34
ttagctggtcccttgtgcctttggggtatgcctcggggtttggtggatggggtgatctcc
cctcactgcaccaacttcgctgtggatgggttttggtctagagtggcccctgggacagaa
agagaggtcattctgtccacagtacttaaaaaccaggacctggtattcatatctgcacag
GAGGACCATAAGATCCAGCTGGAGTTGGATTCGCAGAGGTTTTCTTTCTTTTTTTCCACT
GAGGATTCTGAGGTTAAGAATGAGGCTGCCACAATGCAGCGTCCCTGGGCAGCATTCATG
TCAGCATCTATGTGGATGGCACCTCTGGAGTGTGCAGGGAACAGACT
gtaagtctgtccctgcggccctgggagaggaaagttaagttctgtggagcacatagcaaa
gaaagagtttttatcaccactgctgtagcgttgccttgagcgctcagtggggggacaaag
tttggaaggtgttttcgcagcaatactgacttccattatgagatgggaattataaaaata

 1.05 Intr +  36561  36816  256  0  1   74   99   401 0.984  37.25
tttcccaaatgcagttcccaattccaaaggcctttttgtctcaggttaccatttgtccgc
tgctagtttttccaacttaaagttttagcttgctttcaaaagggtagatgctgctagcag
gagaatgtgcctctttttcctggaggttaatctcactggtccccatccacccacccccag
GAAAATATGCAAGTCTTGCAAATGCAGCCAAGAGGACCACTGCCTAACATCTGACCTAGA
AGACGATCGGAAAATTGGCCGCTTGCTGATGGACTCCAAGTATTCCACCCTCACTGCTCG
GGTGAAAGGCGGGGACGGCATCCGGATTTACAAGAGGAACCGGATGATCATGACCAACCC
TATTGCTACTGGGAAAGATCCCACTTTTGACACCATCACCTACGAGTGGGCTCCCCCTGG
AGTCACCCAGAAACTG
gtaagagagcttccccaaccaagcagttgttttcctatcctcataaatactagccatgtc
aagtgtttctgaatttcaaacatggggtggcaagagctcaaggtcacaaaaatgacagga
gtggctgtggttttagccctgcccttatatcatgtgatgttgagaaatgaagactatctg

 1.06 Intr +  47944  48279  336  0  0  124  102   432 0.988  43.92
ctaaaattacaaaagtaatctaactgcattaagttaagaaaataaagactgtgggtcttt
cagttgctgagaatgctggaagagaatgcattttcagttttaggtagattctgtcatagt
ttctttgactgatgaagccccatccacatcatgttgtctcttcctcctcctcctccctag
GGACTGCAGTACATGGAGCTCATCCCCAAGGAGAAGCAGCCAGTGACAGGCACAGAGGGT
GCCTTTTACCGCCGCCGCCAGCTCATGCACCAGCTCCCCATCTATGACCAGGATCCCTCG
CGCTGCCGTGGACTTTTGGAGAATGAGTTGAAACTGATGGAAGAATTTGTCAAGCAATAT
AAGAGCGAGGCCCTCGGCGTGGGAGAAGTGGCCCTCCCGGGGCAGGGTGGCTTGCCCAAG
GAGGAGGGGAAGCAGCAGGAAAAGCCAGAGGGGGCAGAGACCACTGCTGCTACCACCAAC
GGCAGTCTCAGTGACCCGTCCAAAGAAGTGGAATAC
gtaagtttctcccatgcttccagccaggctgaaaccatgcaggcccagggctggacagtc
agggccccatcacggggctttgttccctcattcatgcatttattcatgaatttgtgcatt
cagcagatattgattgctcatttagtctgtgccaggcactgtcccatggaaaatgataca

 1.07 Intr +  64808  65023  216  1  0  118   59   284 0.991  27.20
gcctgttaggtaggcaatattattgtgtcgctttgcagatgacaaaactgaggcacgaag
aggtatagtgacttgcccaaggtcacccaggaagtagaaaggctggagctggaattcgaa
cccatgtcactgtgctctcctgacttccttgtctcctatggtccttccccatccttccag
GTCTGCGAGCTCTGCAAGGGAGCGGCCCCTCCTGACAGCCCCGTGGTCTACTCGGACAGG
GCAGGCTACAACAAGCAGTGGCACCCCACCTGCTTTGTGTGTGCCAAGTGCTCCGAGCCG
CTGGTGGACCTCATCTACTTCTGGAAGGATGGTGCACCCTGGTGCGGCCGCCATTACTGC
GAGAGTCTGCGGCCCCGGTGCTCCGGCTGCGATGAG
gtgggagatagccgcgagatgggttagggggcttgagggacactgctgagggtaaaagcc
cagaggccaagaggagcatggctttgtggatgatgtgttctacagattgggaaactgaag
tcaggcctcactgcatgctctcaaccttcattttctcatctgcaaaatgaggcagacaac

 1.08 Term +  66816  66974  159  2  0   99   49   227 0.984  17.84
accttcaccaaatattatccttactgcctcaaatttatgccagatttttccactaaggct
ttaaaaggtcaaaacaagaataggatgggatgaaccaccaccctataacttgtcctagat
ataccgtctctacctagggacagaaactgagtcatgcatttctcctgctcccctccccag
ATAATATTCGCTGAGGACTACCAGCGTGTGGAAGATCTGGCCTGGCACCGAAAGCACTTT
GTCTGTGAGGGTTGTGAGCAGCTGCTGAGCGGCCGGGCGTACATCGTCACCAAGGGTCAG
CTTCTGTGCCCAACTTGCAGCAAGTCCAAACGCTCCTGA
agggctgcccacccacagccagaatccacaggatcccaccgagaaggagagccaggtgtg
ccgagaccatcctaagggtccgatgtgacagcaagcaagtgaaataaacaatgatttgct
tttcagtgagaatatatatatgagatatatatagatatatattctaggttgggtggtggt

Predicted peptide sequence(s):


>LMCD1_1|GENSCAN_predicted_peptide_1|548_aa
XPANLAIQPPLSPLRALAPLPEKPGAVPPPQKRMAKVAKDLNPGVKKIISQITNDYDKIG
LKLRSTESGIVEQLFRTSKMKRQLLLLKSLRLEISSYPLPFDNRKRIWPAAATVSPGAGP
PATFAGLLQEHNISLNPRGTIDVPGPAAVSKRCGMFGMQGDVFGLRATFMEEDHKIQLEL
DSQRFSFFFSTEDSEVKNEAATMQRPWAAFMSASMWMAPLECAGNRLKICKSCKCSQEDH
CLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTIT
YEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLEN
ELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSK
EVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCG
RHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCP
TCSKSKRS