GENSCAN 1.0	Date run: 16-Jan-104	Time: 05:40:06

Sequence ITGB5_1 : 126748 bp : 46.86% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1498   1567   70  0  1  108  115   209 0.990  24.81
tgctgcgggacggatggtggcggcggggcgcgggccagcgcgggcgccgtgagccggagc
tgcgcgcggggcatgcggctgcggcccccggccctcggcccccgcgctccggccccagcc
ccggccgccggcccccgcggagtgcagcgaccgcgccgccgctgagggaggcgccccacc
ATGCCGCGGGCCCCGGCGCCGCTGTACGCCTGCCTCCTGGGGCTCTGCGCGCTCCTGCCC
CGGCTCGCAG
gtaagccgcgccgcccacggcgcccagagaaactttgtcgcacactcagccgcgggcggg
cgtctcggaggggcggggagcgcaggcggtgcctgagggcggagggcgccttcggggcac
tccctggtgggccagtcgctgggggacagccccgcggggcgctccccgcgcgcagccccg

 1.02 Intr +  10709  10794   86  0  2   45   68    56 0.069  -1.16
tcaggaggctgaggcaggagaatcacttgaacttgggaagcaaggttgcagtgagccaag
atcatgcccctgcagtccagcttgggcaacaaagcaagactctgtctaaaaaaaaaaatt
atgtggctttgatcagagtcctacgtgaggcctttgacctcaaattcctttctgataaag
GGGCTGTTACAGATCTCCAGAGGACCCTAGAGCTCAGCAGGTCACACCAGCCCTACATCC
AAGATGGCAGAGGGACCACCAGGCAG
gtatcccatgtgggcacttgctggtcaggaccccgtctgacctcttttttgtagataggg
ctccttgtttcaagtcacatactctcattatcttacattttcatctataaaaagaggcaa
cttgactagctcatcttaaaacaatcctagccccaaggtgctataatctcatgattttat

 1.03 Intr +  29052  29256  205  2  1  120  117   133 0.997  18.17
atccttacaatacttggtgaagcatctgggatagggattaccatttcctccattttcaga
caatgaaaatggaaagtagagaatttaaggtcaaccagatggagacgcagccacgacatg
cgatgttttcgggagacaccctgaccacctcctgctctcttcctctttttccctgcctag
GACTTCGGAAGCCCACGGTCCATCACCTCTCGGTGTGATCTGAGGGCAAACCTTGTCAAA
AATGGCTGTGGAGGTGAGATAGAGAGCCCAGCCAGCAGCTTCCATGTCCTGAGGAGCCTG
CCCCTCAGCAGCAAGGGTTCGGGCTCTGCAGGCTGGGACGTCATTCAGATGACACCACAG
GAGATTGCCGTGAACCTCCGGCCCG
gtgagttgcccacagaaagggctggatgctctgggatcaggaaggcccatgggggaggtg
ggacttgttaataatgggacaatgagtcaggccaggctgagatcagagccacgagatggt
gatggggaggcaaggctcagacctcaggaagcagagtatattcttattgatgtgtctgtg

 1.04 Intr +  34844  34870   27  0  0  153   40     3 0.195   0.09
acagagatgttctatgtacccttctccgctgtcctcaatgatagcatcttaatataacaa
aagtacattctcaaaaccaggaaaccaacatggttacaatactattaactaaactacagg
taattggttgcttttgggtttcctgccagcccctatttttttcctcccttctccttccag
GTTCTACTTGGAAGAACCAGTTTTTAG
gtattgcttctgcaataaagttgccaccctgggtgacagtgtacatagcttaaatagacg
aagaaagtcttttgatgatggctggataaggggttattttaaaggaaaccagaagtatcg
agccctgggcttggaggcagacactgtggaggacaactgtgtcttcaggtgacttgttcc

 1.05 Intr +  39940  40189  250  2  1   95  106   407 0.984  39.70
aggcctccattctcagcaccgtattcccttcaggcactttacttccaagaaaaatcttct
gtgaggcacacaatcactaaagaaaagtaagaggcaaactagctttgaaagcaaatccca
tccctcagccctcagcaggttgcacaacctctaacacacgtggcctctctgttggtgcag
GTGACAAGACCACCTTCCAGCTACAGGTTCGCCAGGTGGAGGACTATCCTGTGGACCTGT
ACTACCTGATGGACCTCTCCCTGTCCATGAAGGATGACTTGGACAATATCCGGAGCCTGG
GCACCAAACTCGCGGAGGAGATGAGGAAGCTCACCAGCAACTTCCGGTTGGGATTTGGGT
CTTTTGTTGATAAGGACATCTCTCCTTTCTCCTACACGGCACCGAGGTACCAGACCAATC
CGTGCATTGG
gtaagtgaccagttgcccttctgttgggtacttaagggtgggagaatggagaagcaggaa
aatttagctcaaagaaagaattaaggaaggcatggttaggaggggtggccaggcttaggc
gtttaatttgattaatgataagcatacattctctcctttcctgacgtgtgaagaagtgag

 1.06 Intr +  46947  47115  169  0  1  111   88   142 0.942  16.45
ggagaacaggaactatgttatttatctttgctctctctgctgtgcctgtcctggggcatg
tggtaggtgctgggtaaatagttattggtgcctctcaaggcactcagtgaatgctcagaa
cacttggttaagatttacagacaatgatggaaaagtgactcttctcttcttcctctctag
TTACAAGTTGTTTCCAAATTGCGTCCCCTCCTTTGGGTTCCGCCATCTGCTGCCTCTCAC
AGACAGAGTGGACAGCTTCAATGAGGAAGTTCGGAAACAGAGGGTGTCCCGGAACCGAGA
TGCCCCTGAGGGGGGCTTTGATGCAGTACTCCAGGCAGCCGTCTGCAAG
gtaactttcctttctggtcctgtccctgcatggggaggtcaaggtagagagcgtcagtgg
gtgttggtacttcctgcaggagtctttgagtgccccagcatgtggctcctgaccactctg
aagtcagagggtgagctcagtggaacttctgggaaatctacagcagtcaaatcagccgga

 1.07 Intr +  67024  67185  162  0  0   90  101   217 0.989  23.37
tctcttcggagcctctgtggaatccctccccagtggttttgtgagtgtgccccaggtaca
catggcaaggggaatgcctctgattcaggccgtgactcctggagaggggccagtgccctg
catgaccagggcaggactgggcagaaagactggtgtacccatccaccttctgtccttcag
GAGAAGATTGGCTGGCGAAAGGATGCACTGCATTTGCTGGTGTTCACAACAGATGATGTG
CCCCACATCGCATTGGATGGAAAATTGGGAGGCCTGGTGCAGCCACACGATGGCCAGTGC
CACCTGAACGAGGCCAACGAGTACACTGCATCCAACCAGATG
gtgagtgccgggaaccagatcccccctccctgttgcctctcttgtgaccctgcccgtggt
cttagtacttgcccagccttgaaaccttcctctggccctcagtattcactggctttctga
tcccttcttggggttgggtttcattattcagtcttctccaactgggtttccggaactcct

 1.08 Intr +  68664  68759   96  2  0   73   91    63 0.972   5.31
tactcagttccttagttcaggagctaccaagaaggcttagttattaagggactctaaggg
gccacctaaggaaaaggtgcttccctggcaaatgctggctgctgactgtgcattggagcc
aggtgctggtatctacacctgttaggaatgtcatagccttgacttttgccttggccctag
GACTATCCATCCCTTGCCTTGCTTGGAGAGAAATTGGCAGAGAACAACATCAACCTCATC
TTTGCAGTGACAAAAAACCATTATATGCTGTACAAG
gtatgctgggagggagggaggctagtgatttgtggggtgaagtgggtggtgaggagtgtt
tacaactctgcctatctgggggaaattcaaaggaggggtggaatatagcccagtcttgat
ctaatggaaaataataggaggaaacaattaagcattcgcatagcagtgaataccttacaa

 1.09 Intr +  69383  69496  114  1  0   40   77    57 0.574   0.44
gaaaccaataaatgtcctgagtgaatacagcagtctgcatatggatctgttccatttaaa
gaaactgttcctgggtcaccctggactgccgcatttagtctggggcaggaattcccaaag
aaaccaataagtgtcctgagtgaatagagcagtctgggtatggatctgttccgtctaaag
AAACTGTTCCTGGGTCACCCTGGACCATCTTCAAAAACTCCCCACATGAACGTGCTCCTT
CTCACAATCACAGATGAGCCAAGTTTGAATTACAGATCTCCTCGGTGTGCTCAT
gtaagctaaatgtaaactcgtctctgagattcttttacgtgatgaagcaatgagaactta
atctggaatccctctccaccctccacccccagaacagctggccatagttccctctccttc
ttgctcttgaatgtccacaaaagaacctttgtctgattgtgtttttctattgctcctgcc

 1.10 Intr +  70788  70877   90  2  0   64  101    60 0.961   5.09
cttcttctgtgccatttcttcttgcttttccctgtgggatcttctttagttcatggtggg
agaaggtggcaggatatggttctaggagcctttactgttctagcccagtatagcaatgct
cactctgatggttggcagggcaaaatgaacttatttcttttctttactttttttcccaag
AATTTTACAGCCCTGATACCTGGAACAACGGTGGAGATTTTAGATGGAGACTCCAAAAAT
ATTATTCAACTGATTATTAATGCATACAAT
gtaagtcatcagtttcttcccccactgccacctcccttccaccctctcccactgaggccc
tgcagctgccgcgggctcaggtgggcagttctccgtgctgctcttcttggctctgctccc
ccatccccttgagtttggtatcttcttcctgcttcactcagggtcagggtggagaaaccc

 1.11 Intr +  79342  79476  135  0  0   84  127   100 0.998  14.26
gtgagtgcagagagaagggaaaggatgagggagggccagggaaccaagctcactggctct
tcctttggcttgggattcctgagttagaggaagccacgtgggcctcagaaaaccagtgtg
ggagcacctcagccacagcctttattaaatggttgggcttcattttctctctccattcag
AGTATCCGGTCTAAAGTGGAGTTGTCAGTCTGGGATCAGCCTGAGGATCTTAATCTCTTC
TTTACTGCTACCTGCCAAGATGGGGTATCCTATCCTGGTCAGAGGAAGTGTGAGGGTCTG
AAGATTGGGGACACG
gtaagtctcaccccaagtttgtatgaactcttgttagcattggtcatcagtctttgggtt
ctaataacttttgtgacttattaagagtcctttcggaatttatattctgttttccaattc
agcatcccagaggagtctcctaagcctgttttgcatgatgtgttcagagtctcaggtgaa

 1.12 Intr +  86215  86265   51  0  0   28   89    77 0.256   0.90
gacagaaggggtgcacttacagctgggaccagtctggttttcttaaccctggcccaagaa
ggcaaactttccatcccttctctcaggctgaactgtctccaaagcattgacagttgggct
ttggcaagcaggggtgctactgagtgtgtgagtatttccctctggacgtgtgtccccaag
CCATACATTTCAGAACTTGCCAGTGACTGTGCTGACATCCACTCGTACTCA
gtaagtgtttatgtaccaaatcccgtgctcactcaagatggacaaatgaggccacagatc
aggggctcagagtctggtggaggaaataacatgcagaggagtcagccccgtagagggtga
tgagtgctgtgggaaagccaggtgtggcactgcaggagcccaaggaagaagggcccagca

 1.13 Intr +  91504  92110  607  0  1   39  111   585 0.015  47.92
aagaggataggacagaagagaaaagaaagggagaataagaactgtgtgaactcaaggaag
ccctatagctttccgcaggggcccatttcctcagggtcatggggatgcaaagagataatg
aatgttaaagaattcacctgtcaaatgtgagctcacctgtgcattctcttctccatgaag
CATGGGAGCTTGCTGGTTCTGAGGTCTCTTCCTACTCCGGCCATCTTGGTGGTTCTACCT
GAGTGCGTGGAGAGGGCTGGAGTTCGCAGCTGCTCTTCATCAAGGGCCCTGCCCCTGGGT
GAATGGGAGACCCTGGCTTGCCGCAGCCATGATATCCCTTCTCTTCCTTCTGCCCAGGCA
TCTTTTGAAGTATCATTGGAGGCCCGAAGCTGTCCCAGCAGACACACGGAGCATGTGTTT
GCCCTGCGGCCGGTGGGATTCCGGGACAGCCTGGAGGTGGGGGTCACCTACAACTGCACG
TGCGGCTGCAGCGTGGGGCTGGAACCCAACAGCGCCAGGTGCAACGGGAGCGGGACCTAT
GTCTGCGGCCTGTGTGAGTGCAGCCCCGGCTACCTGGGCACCAGGTGCGAGTGCCAGGAT
GGGGAGAACCAGAGCGTGTACCAGAACCTGTGCCGGGAGGCAGAGGGCAAGCCACTGTGC
AGCGGGCGTGGGGACTGCAGCTGCAACCAGTGCTCCTGCTTCGAGAGCGAGTTTGGCAAG
ATCTATGGGCCTTTCTGTGAGTGCGACAACTTCTCCTGTGCCAGGAACAAGGGAGTCCTC
TGCTCAG
gtaagtgtccccagcaagcactttagctctgagccaggccaagatgccgttaggacaccc
tcccaaagcctgccttttactcagtggtggtagaaagtgtcactaccatggctctccttg
gagaagacagtgggcaagccttgctacccgtaggcaggaggtggggatctgtgtgcagaa

 1.14 Intr +  92818  92914   97  2  1  117   85    -5 0.823   1.17
tacctcctagaagctccaggggagaatctgtgtcccggccttttccagttcctagaggcc
acctgtattctttggcttgcagctccttcttccattttcaaaaccagcagagtaacatcc
tcagatctctctgactctgacctctgcttctgttgtcaaatccttctccctctcctacag
ACCCTTGTGGTTACAAGGGACCCTCAGTCGAACCCTGGAAAGTCTCCCCATCCCCAGGTC
CTCAGCTTACTCACATCTGCACAGTCCCTTTCACCAC
gtaaggccacacagtcacaggttccagggattaggatgtggacatctctgggggctctta
tttttcctgccagaattcctcttttttttttttctgagatggagtctcactctgttgccc
aggctggagtgcaatggcaggatctcgactcactgcaacctctgcctcccaggttcaagc

 1.15 Intr + 101911 102011  101  1  2   87   76    15 0.286  -0.05
tggagctatgttgatctttggggtgagtgtctgtcatgctcagaacactgacctaagagc
tccacccagatccaaaagctcccttgagtctggaagttgctccaagtctgatctgctcaa
aggtttccttcctctttccagggctccctcctgggctctgactgttgttctctgacccag
AGGAGGGAACCTGCTGTCACTCCACCCCATAGCCACCACTCCCAAAGTCTATCAGGTGAG
TCCAGATGTCCCTAAGCTAAAGAAATATGCAACCCAGGTTG
gtatgttatttgacgtcatgaagttggcctttagcaacaggcaaaactatagtaacacaa
ggagaatcttttttttttttttaagagacagggtcttgccctgttgactaggctggagtg
cagtggtacactcagtagcctactgcagcctcaaactcctgggctcaagcaatcctccct

 1.16 Intr + 104890 104997  108  2  0   79   36    64 0.266   0.56
tttcagtgtgaccacaaccatgttcttccagagaaaagagaattcttaattgtctttttc
tcatgttactctgaagtctctgggtttcttggacatttgttaagaatctgaaatatctca
agaatcacatttaagttcttcaggtatcaataatacttctgttccttttcttatgtccag
CATTGGATGTCTTCCCCCAGGGTTTGAGGTTTGTCCTGGTGATATTGTCAACCACAACCA
AAGGACAGCATGTTCTGAGCATCTTCTACACGCCTGACACCATGCTAG
gtgtggggcacagaaacataaaacagaggctttgattgcgtgtgggtttgtaggctaatg
agatgaggcagaccagcaaacaaacaagtccatcagtgtgccaagtgattctatacctac
gtctcttaactaagtcttctggtcagcttttgaacatgctcaggtctgtttaatctctct

 1.17 Intr + 114586 114808  223  2  1   82   69   213 0.879  15.99
cccctgctgtcccttcatgctggctctaggccctctgtctatctccccaaacaggctctg
agggcagagttggtgttccattctctgctgaatcccagtcctggcatgtggggcaccaga
tggttatgtgctcatgtgtaaaggtgagcaggtgctgatgtgccacatgtatccttttag
GCCATGGCGAGTGTCACTGCGGGGAATGCAAGTGCCATGCAGGTTACATCGGGGACAACT
GTAACTGCTCGACAGACATCAGCACATGCCGGGGCAGAGATGGCCAGATCTGCAGCGAGC
GTGGGCACTGTCTCTGTGGGCAGTGCCAATGCACGGAGCCGGGGGCCTTTGGGGAGATGT
GTGAGAAGTGCCCCACCTGCCCGGATGCATGCAGCACCAAGAG
gtactggttccactgacagccccaccttacttctcacccaggccaggcctgtggtccagc
caggcagccctcagggccggctagcctccactcctcacctcctgcatctcccacccagca
agcctcgctggggagccgcattcttaccaaccgtaactgaaactgtggctttcaaatgct

 1.18 Intr + 119385 119485  101  0  2   88  109   110 0.988  12.85
cccttgggcttcctcccataacaagaagaaaggcagagcagaaacattccctgaggctga
acatctgcagctggaaagaagtgaaagccttcccaggtcctgcactgtcaggagctcagg
gacaggtgtgggactgttctacattatctgacacccacctttatctcctcttttccaaag
AGATTGCGTCGAGTGCCTGCTGCTCCACTCTGGGAAACCTGACAACCAGACCTGCCACAG
CCTATGCAGGGATGAGGTGATCACATGGGTGGACACCATCG
gtgagtgtgctgccaccacccgggcagtcacggtttttctccttcctggggaggagggta
gttttagccttgagtcaggaggcactgcccaggcttcctgggcataactgtgggctcccc
atgaggacccggtgctggaaccatcatccacagctgatgggaatgtagaatggtacggac

 1.19 Intr + 122153 122272  120  0  0   88   96   179 0.987  19.17
ctgcattcttggtgtgagaaaactgaactcatcttcaaaggcccagcctccccttaagat
tttctgcccacaccccccatgccctttcctttttcaaggcactcggctccctgccccgac
catcagtggctgtgggctgctcagagagactcaggccattcccgcttggttttcttccag
TGAAAGATGACCAGGAGGCTGTGCTATGTTTCTACAAAACCGCCAAGGACTGCGTCATGA
TGTTCACCTATGTGGAGCTCCCCAGTGGGAAGTCCAACCTGACCGTCCTCAGGGAGCCAG

gtaggtgagggctgcaagggctcggcccactcagccagccctcagttctgatttctgatg
ccattctctgctctgggaccactgccctttctgtcctcatcggccttttgaaactgcagg
gagaggagggatacaatttcttctttttctttttttttttttttttgacacaggctgtca

 1.20 Intr + 123941 124107  167  0  2   77  103   198 0.998  19.88
ctgtcccttttgaatctttcattttttgtacattggggaaaccctcctgaggatctaagg
gagagccgaggagaaggcctttggaaggggtgcaactttcatctcagaaatgcctgcagt
tgcgtgagaggggcatggtgatgctagtggctttgcttaccatgcttctggtccccccag
AGTGTGGAAACACCCCCAACGCCATGACCATCCTCCTGGCTGTGGTCGGTAGCATCCTCC
TTGTTGGGCTTGCACTCCTGGCTATCTGGAAGCTGCTTGTCACCATCCACGACCGGAGGG
AGTTTGCAAAGTTTCAGAGCGAGCGATCCAGGGCCCGCTATGAAATG
gtaagcacgtgggaaatgggaagcagaggagacttcaagctcagaggcgtggttgagttc
agcggtatgttagcaatagaggctcactaatgtctttggcattaaaaacaaaagaatcaa
caccagaaacgctgtgcccagttctggagagagagaattgcacagccccagtgcagagtg

 1.21 Term + 124780 124875   96  0  0   98   41   173 0.999  11.57
gcgatggctttcctggggaacacagagctgtcctagagcccacggccgtctcctcctgag
tgctctgcctgctgctgtcgcagggggctgacctgggaagggatcctagggcctgcgtct
gtcggtttgagtgtgtgagctaacatgtgtcctcatcctcttccccgccgtgttctgtag
GCTTCAAATCCATTATACAGAAAGCCTATCTCCACGCACACTGTGGACTTCACCTTCAAC
AAGTTCAACAAATCCTACAATGGCACTGTGGACTGA
tgtttccttctccgaggggctggagcggggatctgatgaaaaggtcagactgaaacgcct
tgcacggctgctcggcttgatcacagctccctaggtaggcaccacagagaagaccttcta
gtgagcctgggccaggagcccacagtgcctgtacaggaaggtgcctggccatgtcacctg

Predicted peptide sequence(s):


>ITGB5_1|GENSCAN_predicted_peptide_1|1024_aa
MPRAPAPLYACLLGLCALLPRLAGAVTDLQRTLELSRSHQPYIQDGRGTTRQDFGSPRSI
TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
GSTWKNQFLGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKL
TSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFN
EEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGG
LVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKKLFLG
HPGPSSKTPHMNVLLLTITDEPSLNYRSPRCAHNFTALIPGTTVEILDGDSKNIIQLIIN
AYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGDTPYISELASDCAD
IHSYSHGSLLVLRSLPTPAILVVLPECVERAGVRSCSSSRALPLGEWETLACRSHDIPSL
PSAQASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCN
GSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFE
SEFGKIYGPFCECDNFSCARNKGVLCSDPCGYKGPSVEPWKVSPSPGPQLTHICTVPFTT
GGNLLSLHPIATTPKVYQVSPDVPKLKKYATQVALDVFPQGLRFVLVILSTTTKGQHVLS
IFYTPDTMLGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQC
TEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKD
DQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNAMTILLAVVGSILLVG
LALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPISTHTVDFTFNKFNKSYN
GTVD