GENSCAN 1.0	Date run: 16-Jan-104	Time: 07:33:42

Sequence FBXL2_1 : 111583 bp : 38.73% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Term +   1006   1236  231  0  0   32   38   180 0.418   2.89
atctgagcagtagctacttcaggtgctggggtgagtgtcgttttatccttttaaattctt
gttattggtaatttaaaatgttttcaataatcatgcattacctgtataacgtttttttta
aaaaaaaaaaaatccatggtctctttcagctgggcagtctgcggctgggtaatctgtcag
GTGAGGGACATCAAGGTGATCAGACTGAGAGGATGGACCAGATACGAAGTGGGAGAGGCG
AAGAGGCCCAGTTCCAGGGCCGGGGGCGAGGGGTGGGCGGTCCAAAGGGCACCGCCCCTG
CGGGTCACGTGCTCGCCGACCACCAATGGCCGCCTCCGAGCCCACCTTGGGGACGGGGCG
GGGCGCCTGGCTGGCGTCACCAGGACAACGGGCGTCGCCGGCGCCGTGTGA
cttcgggctgtgggctcgctcgcggctcttcggccatggtgagtctgggacccgcgtctg
cctagctgccccgccctacccctaccgggctgggtccgcacgccgccgcccgctagggtc
gggcaggcggcgcaggggtcgtggagaggccgggccgcggcctgcgaggctgctgggcag

 2.06 PlyA -   3465   3460    6                               1.05
 2.05 Term -   6838   5682 1157  2  2   62   32   219 0.061   4.75
 2.04 Intr -  10230   9936  295  0  1   20   71   177 0.210   4.86
 2.03 Intr -  11851  11790   62  2  2   80   65    56 0.310   0.03
 2.02 Intr -  13514  13460   55  2  1   89   96    41 0.368   2.63
 2.01 Init -  28667  28503  165  2  0   37   99   107 0.713   6.38
 2.00 Prom -  37646  37607   40                              -4.85

 3.02 PlyA -  37802  37797    6                               1.05
 3.01 Sngl -  48663  47806  858  0  0   86   44   232 0.904  14.18
 3.00 Prom -  49788  49749   40                              -6.95

 4.01 Init +  68931  69082  152  2  2   76   85    61 0.298   4.17
ttgggaatcctttcagatgttaagatagaaacaatgaaagtcttatgttaacttttccca
gaaaacagaaaaagaacatttactatattcattttctatgtctgctttaacaaattgcca
caaactggatgacttaaaacaacagttctggagatcagagtctgaattcaaagtgtgagc
ATGGTTATGCCCCCTCTGAAGGCTCTAGGGGAGAATCCATTCTTTTTTTGGCTGTGTCAC
TCATCAGTCTGGGCCTCTGTGGTCACATTGCCTCCTTCTCTTCTCAAGATCCCTAACTTA
ATTACGTTTGCACAACCCTTTTTCCAAGTAAG
gtaatattcacaggttctgttgattaggtcacaaatacatctttttttggtggtagtggg
gcacacatcattcaacctactacattttctaattcattttatgagactaggataattctg
gtatcaaaacctaccaggacattataagaaaggaaatatacagaccagactttcttgtga

 4.02 Intr +  82726  82780   55  1  1   97   75    23 0.280  -0.04
gcaaacacttaatatttcactgtagtgatgtaaagttatagtgcacttgtatatttcaga
ttgaggaatcttgaaaaaacttatgtatccaggtggcggattagagtttatctttcaagt
tataattatcctgaaatgttaacaccatctcgtttttgtgtttttttcctctctctgtag
AATATTTTCCTTCTTGGATATAGTAACTTTGTGCCGATGTGCACAGATTTCCAAG
gtagagtattcaccagattttttaatcaataaatatcaagttttattagaatgagtttta
gttcaaattactgaaaattaaaattttattatcttttatacttaatataacataatggta
taattttgcatttgatgattaacttaatatacatcaaaaataggagtttggaaataaagg

 4.03 Intr +  83042  83116   75  1  0   92  107    43 0.694   5.39
aattttattatcttttatacttaatataacataatggtataattttgcatttgatgatta
acttaatatacatcaaaaataggagtttggaaataaaggttaatcaagactttctttaat
agtctcaataaatgtgtttctttcatcccaatccctcttcctttacctcccaccttccag
GCTTGGAACATCTTAGCCCTGGATGGAAGCAACTGGCAAAGAATAGATCTTTTTAACTTT
CAAACAGATGTAGAG
gtaagttagctttggtttagacaaaaaactttttaaaaatatgagtagctgttccccctt
tcctgactttttattttactgcatttagatctaatattaaagtgctgaggtagaacagaa
agaagaaaaactggaagggatttgcatacatcaaaacaaaaccctgcttgcattttaaat

 4.04 Intr +  96100  96169   70  0  1   82   47    54 0.171  -1.46
ctcaagggatcctcctgctttggtctcccaaagtgctgggattacaggcatgagccacca
tgcctggcctgtacttaattcttgaggggcaccctccacagatctctggagttctctttg
tgacgttctctctactccaatgctcttgccagataactccagctgccttggtcttcctag
AATTTCAGCCCCATTTCTTCATCTCAGACAGTCCCATCAGGCTTGGTTCCCCCTACCGGT
ACCAGGGCAG
gttggaaggagcaaatctcaaagctgtatttcagaatgatggagacgacctgagctagtc
cttgctgaatatgttaagcagtgagtggtgaatagggcgttttaatgtgctgcttctggc
cttgctaccaacccacagatcaatgaggaagttcctcttcatgactgaatgtcctcacca

 4.05 Intr +  96802  96919  118  2  1   58  111    67 0.325   4.60
ccctagactagcagcactggcatcacctgggagtttctttgaactgcagactgtcgagcc
ccattctagatctatcatcagaatctgcactgtgacaagaaccctagctgattgttacgc
gctttaattaagtttgagggagcgctgttctaagcgtgaatggtttcatatgccctctag
TGGCTGTCCAGCAACTTGCAGGGAGCTTTAAAATGTTTTCTCATTTTAGGACCTTTGCAC
AGAACTGCCGAAACATTGAACATTTGAACCTCAATGGATGCACAAAAATCACTGACAG
gtaagtaatgaagattaattggtgaccaaatagccacggggagagagaagggagagaaac
gtggttgaaaatatctttagtgcgtctgctctttttcagcacgtgttatagccttagcag
attctgttccaagctgaaacatctggatctgacctcctgtgtgtctattacaaacagctc

 4.06 Intr +  97337  97463  127  2  1   86   81   156 0.998  14.46
tatgaacattctggaaaccttcttaatggtcacgttggatccagcaagaaataggtgact
ccaagaggtcccaggcatggtctccccttcggaatttcttgtgatgtactaaactcagag
ttggtcattaactctctacaggagagactgcacataagtttttgtttcttgttctctcag
TGAGGGCTGCCGAAACCTGGAGTACCTGAACCTCTCTTGGTGTGATCAGATCACGAAGGA
TGGCATCGAGGCACTGGTGCGAGGTTGTCGAGGCCTGAAAGCCCTGCTCCTGAGGGGCTG
CACACAG
gtaccagagggttgatacagctgtttgtgttatgtgtcaggtgtgggcacatcatccaga
aagctgcttttgcatttttcttggtgtcccactgttccctcacctggattccagctgtct
tttgttttctctgtccactcagttagaagatgaagctctgaaacacattcagaattactg

 4.07 Intr +  97606  97680   75  0  0   72   89    71 0.922   4.39
gaggcctgaaagccctgctcctgaggggctgcacacaggtaccagagggttgatacagct
gtttgtgttatgtgtcaggtgtgggcacatcatccagaaagctgcttttgcatttttctt
ggtgtcccactgttccctcacctggattccagctgtcttttgttttctctgtccactcag
TTAGAAGATGAAGCTCTGAAACACATTCAGAATTACTGCCATGAGCTTGTGAGCCTCAAC
TTGCAGTCCTGCTCA
gtaagtagcgtgcctttcctgaacactgtttgctctatcttgtctcccaaagcagtctgc
ctcaggcctccctgcagccccctaggcacctgagatgggctgtgttgccacaccctgatt
tccatcctgtgtccttatataacctaccaatttgtcacaagctggaacaacaacaacaac

 4.08 Intr +  99047  99177  131  1  2  108   73    95 0.981   8.57
taaagctgtgcagagataacacaagtacctgtctaccctctacttattttgttgaagtta
tttggataaaatgctagtaatcagcaaccaaaactgaacaacagcagatacttttctgct
gctcccgttttggtattgctggtgtcctctgacttttctttctgtgctgcttttcctcag
CGTATCACGGATGAAGGTGTGGTGCAGATATGCAGGGGCTGTCACCGGCTACAGGCTCTC
TGCCTTTCGGGTTGCAGCAACCTCACAGATGCCTCTCTTACAGCCCTGGGTTTGAACTGT
CCGCGACTGCA
gtgagtacactgcactttttgctttgcagctcagagtttggctgagttaaccaagagggc
ttccttcaggagaggacaggcttgccaggtagtggtggtggaggcagtagttatgttgtt
gttggcttttgttgggtaaattggggtggggcgtgtataaatccagttcattggaggatg

 4.09 Intr + 101032 101092   61  1  1   91   90    30 0.963   1.32
tactttccaagtttgggatggaacttcggggctttgggcaggtcacattccctaagggct
gttaacagaggcaaaagcatgtcaaagagcagaaaagactcaagtatgcatcataaaata
tgtgtttccattattaactagttggtaccgttttctcccctgtacccactttctcctcag
AATTTTGGAGGCTGCCCGATGCTCCCATTTGACTGACGCAGGTTTTACACTTTTAGCTCG
G
gtaaggcatagatttaaagaatacaaccaaactctaattcacctcccgaattcaaagtga
cttggagtggttttgggtgtgcaaaagactaccttcagaaaagacaggcacaaagtagag
tagaacccttggggtgtgtactgcagtttttccagttagccagaaatctagggaagtcct

 4.10 Intr + 101862 101906   45  2  0   64  105    88 0.909   5.79
tgtaactcaaaaggcagctgttcagaagtgctggtttactgggtagctttaggaagaggg
catacttcttaacagaagagaacaaggacactgggccaatactcagagggatagggcaag
ccaccattgttgctgtcaccactgactcacatgtggggtgtgtcttgtggactcttccag
AATTGCCACGAATTGGAGAAGATGGATCTTGAAGAATGCATCCTG
gtgagtggactcctgacagccctgcagggcagcctgctccttagtcattgctggccagtg
cagcacagccagagacactgactcgctatcatcctgaccctccttgatcaacctcagtgg
cagggcttggaaacctgtgaaggccatggcagtggatgcgtgaacttttggccattctca

 4.11 Intr + 107748 107960  213  2  0   91   77   333 0.985  30.49
gaacagaaacttctcatagttctgaaggctgggaagtccaggggctggcatctgctgagg
gcattcttgctgtgtcatcccattgcagaagggcaaaaaggctagcttccagcttttttt
taggacttgagccttggaataagggtcctgcaaacatttactcatgtcttcctgttccag
AGCCTGTCCCACTGTGAACTCATCACAGATGATGGGATCCTGCACCTGAGCAACAGTACC
TGTGGCCATGAGAGGCTGCGGGTACTGGAGTTGGACAACTGCCTCCTCATCACTGATGTG
GCCCTGGAACACCTAGAGAACTGCCGAGGCCTGGAGCGCCTCGAGCTGTACGACTGCCAG
CAGGTTACCCGTGCAGGCATCAAGCGGATGCGG
gtaggtatggggcaggggagtcagtcacacctgacatttctaagcaccaaaggaaaacat
caagaatcagaccggggctaggcacgcggtggctcacgcctgtaatcccaacactttcag
aagccaaggtgggtggaccacttgaggtcaggagttcaagaccagtctggtcaaaatggt

 4.12 Intr + 108950 109053  104  1  2   15  111    62 0.914  -0.75
agagtgaaactctgtctcaaaaaaagaaaaaaggcctatggtaaaggcaagcaatttaag
gtcattatgagtgggaggtagaactctcttggctaatttccaggtaagagagcttaacag
aatttggctttttccatatagttcacctacactgttttcttgattatgctttaagtttag
GCAACTGCATTTAACAGCCCCATCCAGGGTGCTACAGCTGTAGAGAACATTCACTTAGTT
TGTAAACAGGGCTGGTTACTACCCCTGGGTGGAAACGTATCAAC
gtaagtgttttcacttatccttagaaggtactaatggggggcagacggtgcggggagtaa
caggagtagctctaatctatagcataaattctacttcaactaaggtgaagatttttaata
gaggactataggtttttctagaattatgactataatcctaaaaatagtaatgtgtaaaga

 4.13 Term + 109260 109461  202  0  1  114   37   124 0.892   5.78
ggtactaatggggggcagacggtgcggggagtaacaggagtagctctaatctatagcata
aattctacttcaactaaggtgaagatttttaatagaggactataggtttttctagaatta
tgactataatcctaaaaatagtaatgtgtaaagactccacttttttcttcatccttccag
GCTCAGCTCCCTCATGTCAAAGTCCACGCCTACTTTGCTCCCGTCACCCCACCGACAGCA
GTGGCAGGAAGTGGACAGCGACTGTGCAGGTGCTGTGTCATTCTCTGACAGCAGCTGCCT
GGGCCCAAGGGGTGATGAGGCATCCTTTCCTCTAGAAGACCTGAGTCTTCCTGACCGACT
CCACCATCACCCAATCTGTTGA
ttctccattgggaaaggcatttacaggtaaaagacttctgtatggattgcagttactctg
gtgatagttttcacctttattctgctgtgaaacaatcaaatcaaagccttgtgtcagtta
acacatgacaagtggtctcaatgcagctaggaccatgccagaaacctggatctcttaaga

Predicted peptide sequence(s):


>FBXL2_1|GENSCAN_predicted_peptide_1|76_aa
VRDIKVIRLRGWTRYEVGEAKRPSSRAGGEGWAVQRAPPLRVTCSPTTNGRLRAHLGDGA
GRLAGVTRTTGVAGAV

>FBXL2_1|GENSCAN_predicted_peptide_2|577_aa
MLNITRIQGNSKQKHNKVPFYTSLAKIKTCDNTKCWKEIQFGTESLIHSLYEHKLHPNSY
SNVLIEGPWEKLAVLEEEVADIDTTQDSSEIQSEPNWETSPSRGRLTPHTARCPSETKLP
EEGSGSNICRSAIFAVLMPPLVIPRQTGSGVDLQQTPTDLQLRVLTVRRKTNKQKGHPHQ
NPICTSPSSKTKVLKVLARAIRQEKEIKSIQLGKEEVTLSLFADDMIVYLENPIISAKNL
LKLISHFSKVSGYKINVQKSQAFLYTNNRQTESQIMSELPFTIVSKRIKYLGIQLTRDVK
ELLKENYKPLLNKIKEDTNKWKNIPCSWLGRINIVKMAILPKVIYRFNAIPIKLPMTFFT
ELEKTTLKFIWNQKRACIAKTILSQKNKAGGTMLPDFKLYYKATVTKTAWYWYQNRYIHQ
WNRTEPSEITPHIYKHLIFDKPDKNKKWGKDSLFNKWCWENWLAIYRKLKLDPFLIPYTK
INSRWIKDLNVRPKTIKTLEENLGNTTQDIGMGKDFVTKTPKAMATKAKIDKWDLIKLKS
FCTAKETTIRVNRQPTEWEKIFAIYPSDKGLISRIYK

>FBXL2_1|GENSCAN_predicted_peptide_3|285_aa
MAILPTVIYRFNAIPMKPPLTFFIELEKTAFNFIWNQKRARMAKTLLSNKNKAGGITLPD
FKLYYKATVTKTAWYWYQNRYIDQWKRTEASEIMPHIYNHLIFDKPEKNKQWGKDSLFNK
WCWENWLAICRKLKLDPFLIPYTKINSRWIKDLKVRPKTINTLEEDLGNTIQDIGMGKDF
MTKTPKAMPTKAKIDKWDLIKLKSFCTAKEAIIRVNRQPTEWENIFAIYPSDKGLISRIY
KELKQIYKKKKIHQKVGKGYEHTLLKRRHLCGQQTYEKKLIITGH

>FBXL2_1|GENSCAN_predicted_peptide_4|475_aa
MVMPPLKALGENPFFFWLCHSSVWASVVTLPPSLLKIPNLITFAQPFFQVRIFSFLDIVT
LCRCAQISKAWNILALDGSNWQRIDLFNFQTDVENFSPISSSQTVPSGLVPPTGTRAVAV
QQLAGSFKMFSHFRTFAQNCRNIEHLNLNGCTKITDSEGCRNLEYLNLSWCDQITKDGIE
ALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHR
LQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEE
CILSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCRGLERLELY
DCQQVTRAGIKRMRATAFNSPIQGATAVENIHLVCKQGWLLPLGGNVSTLSSLMSKSTPT
LLPSPHRQQWQEVDSDCAGAVSFSDSSCLGPRGDEASFPLEDLSLPDRLHHHPIC