GENSCAN 1.0	Date run: 16-Jan-104	Time: 07:43:31

Sequence ENTPD3_1 : 43816 bp : 42.17% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +    849    905   57  2  0   95  109    17 0.265   2.66
aaggtcatgcacacccacagagtgcccagtccctgcctggccttgtccccattttccctc
cacctagggttggggtgacaatggaggtaactagaagacagatcaaaaggttcttggtct
tgacacagatgcaagaaggaggcagataatagacacctcccttccccctcgcccacatag
GCTCCGGTGGGTTCTCAGGGCAAGGCCTGGCTCCCTCCTCTCCGACTTCAGGTACAG
gtgagtgtggagggaactgaaagaggaaaggtgaagtgctgtttggcttcgacctggagg
gggacagaaggctctctgggcaggcagggccggtcttttggcaagaggcgcgctctctct
cccttccccttccatcgagggctgggtgtgaaggtgagagcaatcagaaaagaaggtgaa

 1.02 Intr +   2045   2096   52  1  1  114   92    25 0.476   3.06
gaaatttaagctccagctttggggctgtctctgaagttctggggttcggcttacctttcc
cgggatgaggttttgatttggaggaagtaaaatgggttttgtcttaacctgggctcgttc
tttaaacttgtgaggccggggcggtggacttactgacatcctgtattctctcacctgcag
CTAGGAGAAAAGATGTTCACTGTGCTGACCCGCCAACCATGTGAGCAAGCAG
gttagtatctctcagcaggtagcaagcgtggttttgccaaatcgcaagagaaccccagct
tcggcctacagtttttcatccatatcccctgcaaatgattgtttaactttattggtttga
gactcagtactcagctgggtttcaacaccggcattcctcaaataaaagtaatgcttttca

 1.03 Intr +   6022   6149  128  2  2  107  115   133 0.904  17.38
cccaaaactggggagaaggggagcttatttgctactccatcttagaagtgtgggtctcgc
taacaccagagaaggtggtttatgcacctgattatggggccagtccatcaattctacaaa
gaataccagtgcctggtttttacctccccctcaagtgtcttctgggtcttctcattttag
GCCTCAAGGCCCTCTACCGAACTCCAACCATCATTGCCTTGGTGGTCTTGCTTGTGAGTA
TTGTGGTACTTGTGAGTATCACTGTCATCCAGATCCACAAGCAAGAGGTCCTCCCTCCAG
GACTGAAG
gtaagtgtgaagggactggcaacaaagggaagaaatgagcataaaggggaagaaatcaat
tattccaaaaccatgagttagaagagcagaaaatcctttccccccatctctggctgaagc
caggagaagttagtgtaagacgcaagggagaaggtctggacatgctgggtttgtgatatt

 1.04 Intr +  14893  15010  118  0  1   98  116   140 0.969  16.92
cttccctcacaatccaaggagacaaaattggtttggagaaaataatttttcttattgatt
agcccttccctaagcgaagcagtgtggattaaggtactcagggttctcagtggcccactg
agaaagcagtcctcagaggagtcccgcccattctgactctccctttccctttttattcag
TATGGTATTGTGCTGGATGCCGGGTCTTCAAGAACCACAGTCTACGTGTATCAATGGCCA
GCAGAAAAAGAGAATAATACCGGAGTGGTCAGTCAAACCTTCAAATGTAGTGTGAAAG
gtaaggactgaagtgtgtctgggagtcacaatgggcagcaaggtagagttctaagtgttt
tggaggcctggagaggtcctgagatgttgcttggaggcagggaatgagcattggactggg
agtcaggaaataggagatcgtgtgctagtgctgctactcatcagtggaataaacttgctc

 1.05 Intr +  25811  25961  151  0  1   90   88    71 0.884   5.60
cttttagaggttgcaagtatactgatcagtgtgaccatacgggacttaccacatccagct
gttttcgaccccctaccaaaccccaataattttcaaagccaatttgttttttatttaaaa
gttgtatcactgcgattggttcctggaaatgctgacagatgctgactgcttgcttttcag
GCTCTGGAATCTCCAGCTATGGAAATAACCCCCAAGATGTCCCCAGAGCCTTTGAGGAGT
GTATGCAAAAAGTCAAGGGGCAGGTTCCATCCCACCTCCACGGATCCACCCCCATTCACC
TGGGAGCCACGGCTGGGATGCGCTTGCTGAG
gtaaaggctaagtggcacaaaggagcccatttgaccaaaataaccaagaatatgttgaat
cttgccaagaatgtaactctatttctgggaacaaccctcgccccccaaaaagaagcccac
attctgccataaatttgggctttaaaggttgggaaacttttagtttttattttaataccc

 1.06 Intr +  28680  28839  160  0  1   86   85    60 0.951   4.57
agttgccccagaaggcttcaacttgcaaaagggattgtggtgtacagcacacatctggaa
aatcattcatccccaccagcagggagacggtgaagtttgcattttcacctgagtgagact
atgtattttaagactgtattgtctgggcactcagacttgtttgttctgtgccttgtacag
GTTGCAAAATGAAACAGCAGCTAATGAAGTCCTTGAAAGCATCCAAAGCTACTTCAAGTC
CCAGCCCTTTGACTTTAGGGGTGCTCAAATCATTTCTGGGCAAGAAGAAGGGGTATATGG
ATGGATTACAGCCAACTATTTAATGGGAAATTTCCTGGAG
gtgtgtgcaaacaaatgcatggtttttaatcttactgtttatcctatcccctgtgagtga
tagcctaagtagaggtacatgccatcagggatatctgccctgtatcactcctaccatgta
acgcattagggaaatacctatgagacaatagctaagaaagacatatatagctggggagaa

 1.07 Intr +  29839  30072  234  0  0   78   80   226 0.845  17.76
ctgcccagttcctgtaagcattttaattcaccacctctaaaagaaaaggaaagaattggc
ctcacatgctccctctgtcctacttcttagtaataggagacgaggcttgggtggagaact
ctgggcaaacagagatggtgcctttggctttctttctcacttccttttcccactgtgcag
AAGAACCTGTGGCACATGTGGGTGCACCCGCATGGAGTGGAAACCACGGGTGCCCTGGAC
TTAGGTGGTGCCTCCACCCAAATATCCTTCGTGGCAGGAGAGAAGATGGATCTGAACACC
AGCGACATCATGCAGGTGTCCCTGTATGGCTACGTATACACGCTCTACACACACAGCTTC
CAGTGCTATGGCCGGAATGAGGCTGAGAAGAAGTTTCTGGCAATGCTCCTGCAG
gtacttgagtcgggggtagggggtggcaggtgttctcttgagggtttgagctgaggggag
aatgccctgccttctggggtctgtcctctccacttcaattgaaaggtagatggaaataac
agcattttccaatttactcctgggggtccaagtccctttcctctctgtctctttcttccc

 1.08 Intr +  36849  37121  273  2  0   86   83   181 0.747  14.21
ctacaaaggacatgaactcatcatgttttatggcttcatagtattccatggtgtatatgt
gccatattttcttaatccagtctatcactattggacatttgggttgattccaagtctttg
ctattgtgaatagtgccgcaataaacatacgtgtctaacaccttactcttatacctacag
AATTCTCCTACCAAAAACCATCTCACCAATCCCTGTTACCCTCGGGATTATAGCATCAGC
TTCACCATGGGCCATGTATTTGATAGCCTGTGCACTGTGGACCAGAGGCCAGAAAGTTAT
AACCCCAATGATGTCATCACTTTTGAAGGAACTGGGGACCCATCTCTGTGTAAGGAGAAG
GTGGCTTCCATATTTGACTTCAAAGCTTGCCATGATCAAGAAACCTGTTCTTTTGATGGG
GTTTATCAGCCAAAGATTAAAGGGCCATTTGTG
gtaagagcaaaaccttctgaaagattcctttccccattgaatattcatttctcacttttc
tgtttctcctctgctgacttgttagccaccttcttattcctcacccataaacctttctat
tataccccattctgagaactaattttcttctgtattacttatttccaggcttttgcagga

 1.09 Intr +  37290  37400  111  2  0   92   82    28 0.824   2.26
gggccatttgtggtaagagcaaaaccttctgaaagattcctttccccattgaatattcat
ttctcacttttctgtttctcctctgctgacttgttagccaccttcttattcctcacccat
aaacctttctattataccccattctgagaactaattttcttctgtattacttatttccag
GCTTTTGCAGGATTCTACTACACAGCCAGTGCTTTAAATCTTTCAGGTAGCTTTTCCCTG
GACACCTTCAACTCCAGCACCTGGAATTTCTGCTCACAGAATTGGAGTCAG
gtcagtatttaaagagaagggatcaatgtcagtacaaaaaaatatggtagaatctattct
atgtgtgtgtattctgaatttagcctttatgctcttctatttccatcacatctgtaaaat
aaaaggaataagggaatctactcccacacctgtggtgtgaattaatgttataactacatg

 1.10 Intr +  37825  37962  138  0  0   76  100    75 0.862   7.24
gtgatattatatagggatattttcataattatattgtgtgattatatgattgtattataa
agtattttctattatgaaattatgggtgataagattctttaaaacatgacttttaaccca
aggtgttcattttaaaacatacctgcctgccctgcctctcagatgttttaaacctttcag
CTCCCACTGCTGCTCCCCAAATTTGATGAGGTATATGCCCGCTCTTACTGCTTCTCAGCC
AACTACATCTACCACTTGTTTGTGAACGGTTACAAATTCACAGAGGAGACTTGGCCCCAA
ATACACTTTGAAAAAGAA
gtaagttaagcacaaatcattttctcttcttcttcccaacagagaggtttgtatgtgtgt
gtggaacaaatgtagaaggtaaaagggtattaatgagttaaactcactgggtggaagctg
atcagactgatcccttgtgagtttcccagaagaggtcatggagaatttagaagagttgct

 1.11 Term +  41271  41507  237  2  0  133   52   127 0.529   8.78
tgagatttccccaagcctttgtggctacagtgtggtgtcttaacttgggcaagtcctttg
acctctttgggccacaatttcccatgggagctttgtgaggttgatagcagtatgactccg
gtatgtgattgcagccttgagccttgccctgagcgctgagccatctcctctactccacag
GTGGGGAATAGCAGCATAGCCTGGTCTCTTGGCTACATGCTCAGCCTGACCAACCAGATC
CCAGCTGAAAGCCCTCTGATCCGTCTGCCCATAGAACCACCTGTCTTTGTGGGCACCCTC
GCTTTCTTCACAGCGGCAGCCTTGCTGTGTCTGGCATTTCTTGCATACCTGTGTTCAGCA
ACCAGAAGAAAGAGGCACTCCGAGCATGCCTTTGACCATGCAGTGGATTCTGACTGA
gccttcaaagcagctcctggagtccaatggctgcttagagtcagcctgggtggcaccagg
caatgcaggtgaagtggctgccttcaggaaatacaactaactaaaatcaaacacctaggt
cacgtgcctctcaaatactgatttctgccacagcacctcttgaggcatcccttggctatt

Predicted peptide sequence(s):


>ENTPD3_1|GENSCAN_predicted_peptide_1|552_aa
APVGSQGKAWLPPLRLQVQLGEKMFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVL
VSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGS
GISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVL
ESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGA
LDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQ
NSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEK
VASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWN
FCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSI
AWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRH
SEHAFDHAVDSD