GENSCAN 1.0	Date run: 16-Jan-104	Time: 05:19:29

Sequence DZIP3_1 : 90936 bp : 35.57% C+G : Isochore 1 ( 0 - 43 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Intr +   6439   6508   70  1  1   48   99    78 0.827   3.17
ccaattcgtcttctttaacatgagtctctaaagagatatggcacctaccaccattaccag
tctttgatacattttggttacactttcagacaataattcaattgttagattctttactac
tacaatttgtgttctttgtgagaagatgctcttaatatacctcattttcatttaaaatag
GCATCCTGCTGTGGAGGATCAGAGGAAGGAAGAAACTGAGAATAAGCTAGAAAAATCATC
TGGTCAACTG
gtaagagaaagtttaattttcattaactgttagttaattgataattaattatatatgcaa
atgcagtaatacatctagtcagtttaattacgtgttaaaattttttgagtgagcctactt
tcctaccttcataagtaaaatggtcacagttaaatcttgctttgatgattgatactgtat

 1.02 Intr +   9524   9679  156  1  0   53   97    85 0.959   5.19
gttcctagagagcagagaacatattattcttccttagattttttataattctgtcataga
agctaggagaacaagggaaaatgagctttgttccttttttaatgctttggctgatcttag
aattaagagtgaatgagaatatgcaaactgtgtaaatttttaatcaataatgtcttctag
AACAAACAGGAAAATGACATACCTACTGATCTTGTCCCTGTTAACCTACTATTAGAAGTG
AAGAAGTTATTAAATGCAATTAATACTCTACCAAAAGGTGTGGTTCCTCACATTAAGAAG
TTCTTACAAGAAGATTTTTCCTTCCAAACTATGCAG
gtaacgtcataagttgttatttggggcagaagtgcagctgtctgtatatgacttttttaa
ttaaaattctttttaaaccacacagtatagccaaggtcttgaaaaaaatctccatcttac
ttcttgtaaagggctttgttgtcaaccttgactgtagacttctaaaaagttgaacaaata

 1.03 Intr +  14891  15007  117  1  0   46  103    75 0.919   4.54
tacttaaaagcaaacatatgagaacagtgtatctggttggtatggattttttttttttaa
accgtctttatctctatttttaaaattttctccaatgagcatgaattatttgtataatgt
aaacatatgtagatgtttgttcagacttatagacatttttaactgaataattttccacag
AGAGAAGTTGCAGCTAACAGCCAGAATGGTGAGGAAATTGTTCCTGCTTTGACTTTACGT
TTCTTGATTACACAGCTAGAAGCAGCACTTAGGAACATTCAAGCTGGCAATTATACC
gtaagtgttttctttttggaaatttgatataatggacttggtcaacatttctcagtgaga
aaacagccaatgcatgcttattttaaggtgtgggccaatttttatttttttcttttacct
ctagaaaagggtatgtataaattgattgccttcctgtgtcttgtactttcttatatgact

 1.04 Intr +  21794  21934  141  1  0   63   67    52 0.342   0.23
ctgggaatgtgttgggtcacatctgaagccagcatagctctgagtctcacccaaggccca
tggcgagtactgctactactgttgattattcagggcccaagggctctttagtcagcaggt
aatgaaccccgccaggactgggttcttaccttcaaggcagtggattcatttctgccccag
GATGTGTCTAGAAATATTGTCTTGGAGCTAGAGCCTCAGGATTCTACTGTGACTGAGCCG
ATATTCAAGTGGCAAGGCAAAATCGTCTTTACTCTTCTCTCTCCTCTGCTCAAGCAGAGG
GAAGGTGTCTCTCCCAGACGT
gtgagttgttttccctggagttggaggggtgacataagcactcccttgcctgccccatct
ggtatcttactaggttgtatacaccacaaatccactggctccaagcccagcacagcacca
ggacatggccaggaactgcagtccttgtggcctagactgccttttatgtaggaccccaga

 1.05 Intr +  22794  22874   81  2  0  114   87    20 0.880   3.42
gggtcaaattatcaaatatatctaaaatacattatcgttattattagatgactgataatg
ttttgataatttttacttgttttaataattattaattaagcttaggatatttaattaagc
ttgttgtactgaaaagtagcttagtctaaataaccaattaacatatttttttctttgtag
GCACACCAGATTAATATTGGTTATTATTTGACATTACTGTTTTTATATGGAGTAGCACTC
ACTGAAAGAGGAAAGAAAGAG
gtatgtaacatgttatttgccctttataaatctttttacatcttggaataatcaggccaa
agattataatatgaaactaaaaatattaaaaaaggaaacttaatattagcttataacttc
atttcttttatttatcttttgaatgcttaccattcatgtaaaataaaaaattatttagct

 1.06 Intr +  24195  24319  125  2  2   64   94    73 0.961   3.96
actacatgatctttgtaatcacatgcagagatgccaggattcagaatgtgaataaatgac
cagatgattgtattatttttaaagctgccctaatttctccagtttgagaagtaattgttt
attgtaaaaaaaaaaaaaatgacttttacagtagccaaacctagttttatgttactacag
GATTATACAGAAGCTGAGAATAAATTTCTGGTGATGAAGATGATGATCCAAGAAAATGAA
ATTTGTGAAAACTTTATGTCTTTAGTTTATTTTGGACGTGGTTTACTGCGATGTGCTCAA
AAGAG
gtaaggattttaattaacgggtagatgttgcctgtgaagtctcagcattgtgaaatggaa
gtaagtgtgcacagtatatcaggcattgtgacatttgtgctctactgttttatccttttc
ttctttgcctatttgtatagataatttctttaatgtagttgagaatattaaatagcaaac

 1.07 Intr +  27412  27526  115  1  1   80   69   135 0.995  10.33
ccacctgtatttcatgccaatctgccacaggtgagagtgctagtatttgtatttctatgg
catgccagaggttatcaccaccctatttaccacaaaaaaagggttatttgttgtctcatt
ggtaaaccatgcatctacacagtcccgttcaaactaaccttattttaaaatgcctttcag
ATATAATGGAGGACTGCTAGAATTTCATAAAAGCTTACAAGAAATTGGAGACAAAAATGA
CCATTGGTTTGACATAGATCCTACAGAAGATGAAGATTTACCTACAACTTTTAAA
gtaagaaattatttaagagtaacattttatttgtaactaatcagaataaccaactatatc
atattcttacagcaagcatgttcttttattggcacataactttttatacaagaaacaacc
tttattgcattacctagtgcagaacgtatgattcaacaaggagggagaagtgaggtggca

 1.08 Intr +  31303  31422  120  0  0   57   79    64 0.761   2.17
acattgtttactttgaattagggaaatgttttattactattaaaaaaatacatatataca
agtacttcgaaaagggatatgatatggacatattaccaaggtaaaacatgggtagtctta
attgtggtgttaatttattattagtaattcatgagaattctttctgtttttaaaatctag
GATCTTCTTAATAATTTTATCAAGACAACTGAAAGCAATATAATGAAGCAGACGATTTGT
AGTTACCTAGATTGTGAACGATCTTGTGAAGCTGACATTTTGAAGAACACCAGTTATAAG

gtactgtaattgtcaattaacagtatttttaaaaagtaattgaaaaattatatataacta
tataaaataataaaaattatattatgtataaaatattttaaaagagcatttagtttaatt
acaatggtaaagcagttgaaaagttattttactatgagaacttagattcagagtgatcag

 1.09 Intr +  35846  35898   53  1  2   51  121    49 0.843   1.29
ctagttcgtttttttgatcaggattatttattacttaccttgttattcatgttttgtttg
ttttatattcactgtggcttcactctcattgtatgtttcaaatgttaagctaagaaataa
cattaaacattttgaaaattgaactactttagggctattttttttccccattacttgcag
TTTGAAGTTGTGAGAAAGGATGAATATATCACCATTGAAAATTTAGGAGCAAG
gtaagcttaaaataaaatactctgttaccttttttggaatatgcatatattttttggttg
cttaattcttctgtgtttctgtcacctaatagagctgcattaaattttaaggtatgtgaa
aaaatcatatttaattgccatttctttccctctctatcaccacttattgtagacatttac

 1.10 Intr +  40788  40864   77  0  2   97   62    19 0.768  -1.56
aaagtgacagtgtagggttttcattgttggtgagctctatttgttcattattttttctcc
ttcttgaattatttctaggagaagatgaaaatactcacttagccatgctcatactagaaa
tcttgactgactttggtattattttatttccactataacttaatttttttccttttgcag
TTATAGAAAGTTGATATCTCTGAAAATAACTGATACTGATATAAGACCGAAGATCAGTTT
AAAATTTAATACAAAAG
gtattattttatttttatatgccttctgttgaaaagtatgttaaaatttttgacttctct
gtcaactttcatgccattaacaaccacgtctttactgtgtttgtcattcactgagcttgg
gtttataccagcaagcagcgcttggtgtaggctggaaatcacagacaggaagatcagcac

 1.11 Intr +  42514  43131  618  2  0   81   74   232 0.651  12.46
gttttttgacaggcagaaagcagcatgctaattgagcactggctgtggcaaagcactgta
ctatccttcattcttttggaatagtttttatcctacaggagcttaggatacaatgtgaga
gaccaaatagaaaatgagcattaatgtggaatgtcttgacttctcaaaatttattttcag
ATGAAATGCCTATCTTCAAGCTTGATTATAATTATTTCTATCATCTGCTTCATATAATTA
TTATTTCTGGTACTGACATTGTTCGACAAATATTTGATGAGGCTATGCCACCTCCTCTTT
TGAAAAAAGAGCTTCTTATACACAAGAATGTGCTGGAATCCTACTACAACCATCTTTGGA
CCAATCATCCTTTGGGTGGATCATGGCATCTGCTTTATCCTCCTAACAAGGAGTTACCGC
AATCCAAACAGTTTGACTTATGCCTCCTGTTAGCTCTTATAAAACATTTAAATGTGTTCC
CTGCACCCAAAAAAGGATGGAATATGGAACCGCCATCTTCTGACATCTCTAAATCTGCAG
ACATCCTGAGACTGTGCAAATACAGGGATATCCTCCTTAGTGAGATTTTGATGAATGGTC
TCACTGAGTCACAGTTCAATTCAATTTGGAAAAAAGTTTCAGATATTCTTCTGCGCCTTG
GGATGATGCAAGAGGATATTGACAAAGTGAAGGAGAATCCCATTGAGAATATCTCCCTTG
ATTACCATCAGCTATCTGTCTACCTAGGCATACCAGTACCAGAAATCATACAGAGGATGT
TATCCTGCTATCAACAAG
gtactaaatgattatttacttcagccaataaacttccattgattgaatgtctgctctgtg
ccaggcacagtgcaaagggcaagagattcagtgagctcatggttttgggaaaatggactc
atcaggaaggtaatagaaattatagtgctagagatgtttccagaataccatgggaaatcc

 1.12 Intr +  46293  46462  170  1  2   53   -1   202 0.213   6.54
tgtacatattatttggtaactgataaatgaacatcacattttcatcgagtaattgaaaag
agtaagatatattttatttctgttttgtgaatgttgcttttttgggcaaacattataaca
ttgataagaagctgaaattgctttcatctagattttgagaattttgtcttttatgtttag
GTATTGAAATAGAAGAGTTACAGAATGAGGAAGAAGAACTAAGTCCACCTCTCATGGAGT
ACAATATAAATGTGAAATCACACCCTGAGATACAGTTTGCAGAAATTAATAAAGATGGGA
CCTCAATACCCAGTGAATCTTCAACAGAATCTCTTAAAGATCTCCAGGAA
gtataagctctcattaatatttgagttagaagaacttattctgggcctttaatttgttgc
atgtgctgtacttaaagcatcccagataattttagcttatattttcatagtgtttataca
gagcttgaattggaatggtcctttccttccttgcctcagtacttccttccataatctttc

 1.13 Intr +  47268  47312   45  2  0   86  116    19 0.175   2.19
aagactaggattaaaataaaaatgataaaaacaaaaataattgtttccatagaatctaga
aagaaatacctataatattagaaaacaaaagatctcagtggtgagaggaaatatattttg
caaaataacccattgggcaatttgaattacatatttaataaataattttttacctactag
GTTAAGAGTAAACAAAGGAAAAAGAAGAAGACTAAGAATAAAAAG
gtaagagactataatagcattataatactgattatgaacacttgagttaaatacatgaat
tcattgttagaacttaaattagttcaagtagacatatagcacaaatgattcaatagctta
ctgagtatatgattatagagaagtctacatatgttatatcctgaatgattttgaagtacg

 1.14 Intr +  49487  49512   26  1  2   59   84    17 0.213  -5.69
atttcagttttatacttaggtataaaagtatatgcataagtgcatatgacatcatgatat
atatttctttagttatgatcaaaaattttttgagaaacactgacctaaatgtaattatat
tactagtatgttgttttgatatagttgatatagattactaattcttatgttatttttcag
AATAAAGACTCAAAAGAAGACCAAGT
gtaagtattagtttatttaatttttaaatttttcttagtatttttaaggcatactttcct
aatatgacacaggcttccttcctttgggaagttttctcactaagagaagaaggatagttc
cttgtcttaataattaacaagttgctgcttttttatagaaagtaacaaaaagttaaatga

 1.15 Intr +  52495  52660  166  1  1   35  115   194 0.939  15.84
cattatgaatcttcaaaagaaagactcagtatgagcactatccaaacttcctttgatcat
gaacccttctaatgctgagcatcttatgaaaccagtacaatactaactttggaagcaata
gcttagatgaaaattactatacaattgtaaaagctcacattgattatgtcacgactacag
CCCATATGTGGTAGAAAAGGAAGAGCAGTTGAGGAAAGAACAAGCAAATCCACACTCAGT
CAGTAGACTTATAAAAGATGATGCAAGTGATGTTCAAGAGGATTCTGCAATGGAAGACAA
GTTCTATAGCCTGGATGAATTGCATATTCTGGACATGATAGAGCAG
gtaagcatgattagagagggtgcctgccttctcttattgttatctggtttttcctgtgac
tctttaaacagcatcaccctttgaaaagcccagtggtttatactgtttgtgaggagaaag
agaaaagcataaaaggtaaggagggatatatgaaggaaaatagaataaggaaaaaaaaga

 1.16 Term +  54953  55102  150  1  0   70   42   146 0.736   5.13
agctgagggtcctgactgttagaaggaaagctaacaaacagaaagggcatccacaccaaa
accccatctgtacgtcatcatcatcaaagaccaaaggcagataaaaccacaaagatgggg
aaaaaacagagcagaaaaactgaaaattctaaaaatcagagtgcttctcctcctccaaag
GAACACAGCTCCTCACCAGCAACAGAACAAACCTGGACGGAGAATGACTTTGACGAGTTG
AGAGAAGGCTTCAGACGATCAAACTACTCCGAGCTAAAGGAGGAAGTTCGAACCCATGGC
AAAGAAATTAAAAACCTTGAAAAAAATTAG
acgaatggctaactagaataaccaatacagagaagtccttaaaggacctgatggagctga
aaaccacagcacaagaactatgtgacgaatgcacaagcctcagtagccgattcactcaac
tggaagaaagggtatcagtgacggaagatcaaatgaatgaaatgaagtgagaagtttaga

 2.01 Init +  56388  57426 1039  2  1   65   41   436 0.275  30.79
gactttaaaccaacaaagatcaaaagagacaaagaaggtctttacataatggtaaaggga
tcaattaaacaagaagagctaactatcctaaatatatatgcacccaatataggagcactc
agattcataaagcaagtcattaaagacctacaaagagacttagactcccacacaataatc
ATGGGAGACTTTAACACCCCACTGTCAACATTAGACAGATCAATGAGACAGAAAGTTAAC
AAGGATATCCAGGAATTGAACTCAGCTCTGCACCAAGCGGACCTAATAGACATCTACAGA
ACTCTCCACCCCAAATCAACAGAATATACATTTTTCTCAGCACCACACCACACCTATTCC
AAAATTGACCACATAGTTAGAAGTAAAGCACTCCTCAGCAAATGTAAAAGAACAGAAATT
ATAACAAACTGTCTCTCAGACCACAGTGCAATCAAAGTAGAACTCAAGATTAAGAAACTC
ACTCAAAACCGCTCAACTACATGGAAACTGAACAACCTGCTCCTGAATGACTACTGGGTA
CATAACGAAATGAAGGCAGAAATAAAGATGTTCTTTGAAACCAACGAGAACAAAGACACA
ACATACCAGAATCTCTGGGACACATTCAAAGCAGTGTGTAGAGGGAAATTTGTAGCACTA
AATGCCCACAAGAGAAAGCAGGAAAGATCTAAAATTGACACCCTAACATCACAATTAAAA
GAACTAGAGAAGCAAGAGCAAACACATTCAAAAGCTAGCAGAAGGCAAGAAATAACTAAG
ATCAGAGCAGAACTGAAGGGGATAGAGACACAAAAAACCCTTCAAAAAATCAATGAATCC
AGGAGCTGGTTTTTTGAAAAGATCAACAAAATTGATAGACCGCTAGCAAGACTAATAAAG
AAGAAAAGAGAGAAGAATCAAATAGACACAATAAAAAATGATAAAGGGGATATCACCACC
AATCCCACAGAAATACAAACTACCATCAGAGAATACTATAAACACCTCTACGCAAATAAA
CTAGAAAATCTAGAAGAAATGGATAAATTCCTCGACATATACACCCTCCCAAGACTAAAC
CAGGAAGAAGTTGAATCTCTGAATAGACCAATAACAGGCTCTGAAATTGAGGCAATAATT
AATAGCTTACCAACCAAAAAAAAGTCCAGGACCAGATGGATTCACAGCCGAATTCTACCA
GAGGTACAAGGAGGAGCTG
gtaccattccttccgaaactattccaatcaatagaaaaagagggaatcctccctaacttg
ttttatgaggccagcatcatcctgatagcaaagccgggcagagacataacaaaaaaagag
aattttagaccaatatccctgatgaacatcgatgcaaaaatcctcaataaaatactggca

 2.02 Intr +  57969  58417  449  1  2   67   86   178 0.127   7.64
ccttcatgctaaaaactctcaataaattaggtattgatgggatgtatctcaaaatagtaa
gagctatctatgacaaacccacagccaatatcatactgaatgggcaaaaactggaagcat
tccctttgaaaactggcacaagacagggatgccctctctcaccactcctattcaacatag
TGTTGGAAGTTCTGGCCAGGGCAATCAGGCAGGAGAAGGAAATAAAGGGTATTCAATTAG
GAAAAGAGGAAGTCAAATTGTCCCTGTTTGCAGATGACATGATTGTATGTCTAGAAAACT
CCATCATCTCAGCCCAAAATCTCCTTAAGCTGATAAGCAACTTCAGCAAAGTCTCAGGAT
ATAAAATCAATGTGCAAAAATCACAAGCATTCTTATACACCAATAACAGACAAACAGAGA
GCCAAATCATGAGTGAACTCCCATTCACAATTGCTTCAAAGAGAATAAAATACCTAGGAA
TCCAACTTACAAGGGATGTGAAGGACCTCTTCAAGGAGAACTACAAACCACTGCTCAACA
AAATAAAAGAGGATACAAAGAAATGGAAGAACATTCCATGCTCATGGGTAGGAAGAATCA
ATATTGTGAAAATGGCCATACTGCCCAAG
gtaatttatagattcaattccatccccatcaagctaccaatgacttttttcacagaattg
gaaaaaaccactttaaagttcatatggaaccaaaaaagagcctgcattgcgaagtcaatc
ctaaggcacaagaacaaagctggaggcatcacactacctgacttcaaagtatactacaag

 2.03 Intr +  60227  60322   96  1  0   67  100    96 0.989   7.99
caagtaactggtactgtttattaaatgctgtaattgaggggaggtgggtttatctaaatt
gagtgtttgacttgagacaaaaaacgtgaaaggagttagatggcaactttaaatcccttt
caaataactaaaatttttttttgaggaaaataatacatgcatatttcctgtgctcaatag
GGCTCAGCTGGCAAAGTAACTACAGACTATGGAGAAACTGAAAAGGAAAGGCTTGCTCGT
CAAAGGCAGCTTTATAAATTGCACTATCAGTGTGAA
gtaagtatttttgccattagatctgatggaagtgagaagtatttcaaatattaaacttac
tggtgctttctgtttgaaaagaacttagtttgcttttttctttcaatttctggtgacttg
aacataattatctgaaataatattttttattgatcaggatttcaaaagacagttgagaac

 2.04 Intr +  60480  60607  128  2  2   53  108    76 0.813   4.66
ataaattgcactatcagtgtgaagtaagtatttttgccattagatctgatggaagtgaga
agtatttcaaatattaaacttactggtgctttctgtttgaaaagaacttagtttgctttt
ttctttcaatttctggtgacttgaacataattatctgaaataatattttttattgatcag
GATTTCAAAAGACAGTTGAGAACAGTGACTTTTCGGTGGCAAGAAAACCAAATGCAGATT
AAAAAGAAAGACAAAATTATCGCATCTCTTAATCAACAAGTTGCTTTTGGAATCAATAAG
GTTTCCAA
gtaagtgtaaatcttttgataaagggaaattctgcgccgtaataaacagtatctttaata
gttaatctctgcataaccactaggtggcactgtgactacacattaggaacctcaaccaca
cgactgcacttgtttaaaaaccaaccatatttttgtcttgccaactggattgagaaataa

 2.05 Intr +  68031  68099   69  0  0   76   82    90 0.342   4.58
tcagaaacaagatacatttcaaaaggaccaggtataggagttcagttgtattcaggctca
agatttgtggccccaaatggacatactttatctcctccacagctgtagttagagctcttc
tgactgtgttaatgagaaataatttctaacatcttttgactttcttgcttgtttgcttag
ATTACAGCGTCAAATCCATGCTAAAGATAATGAAATCAAGAACCTTAAAGAGCAACTTTC
TATGAAAAG
gtacaaacttagctttttctttgggtgcactctctctgaaactgtatttcactcaacact
ttctggctggcatattgatgtaatttatcattcaaaccggggtacttttgaggctgatat
tgaacagtactaataatacactgggacaaaaggtgtaaactgggagtatcttaggcaaat

 2.06 Intr +  70910  71006   97  2  1   44   77    85 0.259   2.09
gatagtaaaggataacagtagggattgaacaatgtatcttctcttgtttctatgtgctct
atacttttccaagaaataatttcctactgattgtataacttatctttcttcctcctgaat
tagatgaaaaaggctctgcttgatgtaatattgcgagtctttaatgatcatgtatttcag
ATCTCAGTGGGAAATGGAAAAACATAATCTGGAAAGCACAATGAAAACATACGTAAGCAA
ACTGAACGCAGAAACTAGCAGAGCTTTAACAGCCGAG
gtaacaacaaaacggggacaggggtatggggtgaggggaaaagttttacttgtataccat
catactaaagaatttgtaaaagattgttttttgtataaacagaaataagacatcttagga
tcagccaggaaaatacagttgaaagtcttgtgcttttttgactcattggcaaatcatgtg

 2.07 Intr +  72443  72531   89  1  2   62   86    67 0.543   1.75
cattgatttaaaagcttttgtaatgtatcttgaatggtcaaggaacctagatgctattgg
aagaaattgagaaatagctttaaatttacttgagatgattgagaagagaatgttccttta
caagcacaccttcaacttctttctctttctctcaaaaacctgtaggtgtatttcttacag
TGTCGTAGGGATTTTGGTTTGCTTCATCTAGAGCAGACTGAAAAGGAATGTCTCAATCAG
CTTGCCAGGGTGACTCACATGGCAGCAAG
gtaacctttccctcttccttaatgcatcttaattttagagatgttagcaagtgtctccac
ggttgaatataatctgtgatgtgttttacatatgtgacatcagagttcttaaagaagctc
ttgtggtttttttgggttttttttcatttttttccccctgaaattccttttaccagaagc

 2.08 Intr +  74136  74223   88  0  1   52  110    37 0.818   1.35
ttgttatttttagtaacaaacctgtccatacctctttatgtccatttgaagtaattgttg
gtgatgggggtaattttgttttttgttgacatatatgctagaaagcgtgatagacatgtt
tggaaacctaagtgttataaaaagaaagagttttcttttgtgtctccttttctacaacag
CAACCTAGAATCACTTCAATTAAAGGCTGCGGTAGACAGTTGGAATGCCATTGTGGCAGA
TGTTAGAAACAAGATTGCATTCCTCAGG
gtaagtcctgaagtatatttggagaaaattggcttaatgttataggtggtgtaaagttag
aagacatattagtagaaaaatttaaggaagaacatattttccattttagttataaaagtt
tatgccttcactttgagattacttccatgtggttggttgtagataacatcctagactcac

 2.09 Intr +  75847  75948  102  0  0   64   99    60 0.802   4.15
tgtggggatggtctatagaatttttttttttttttggtcagaacctgtttttatattatt
tctgacaggttggcaaccactcttgtatgttgtattattcaaaactacatcagatattcc
catatgctgtctctttaaagttggttgttctctaaagtatttttagtcttcttctaccag
ACACAGTACAATGAACAAATAAACAAAGTCAAGCAAGGATTTGCCTTGAGTACCTTGCCT
CCAGTCCAGCTTCCTCCTCCACCACCCAGTCCTGAGATACTG
gtaagaaatacaacattttgaataattgcccttttcattttgacaaaatggtaagggctg
tgaaacactgaatatgcagtatgtttaacgtgtgttcaaaatggaataggcacatattgt
gagtatcacttgtaattatgaccataccttcgagtcaccagatgatataattagatgggt

 2.10 Intr +  84795  84934  140  2  2   93   82    61 0.272   4.34
ttgtcctatttttaaaataagtttaaaatagttacaaacaattagaaatattaagagaaa
aactgtaaaaattgaatgtgtatgccagtacgcttcttcattgtacccattttctgaggt
ataggaatgtcacttcttaataattaaacctgctgggctatagctctctgcctcttacag
ATGACTGGCATAGCCTGGGCTCTGCCAGCGCCTGTGGGAGACGCTGTGCCTCCCAGTGCA
GGTCTGCGGAGTGATCCCTCCATCATGAATTGGGAGAGAATTACAGACAGGCTGAAAACT
GCCTTTCCACAGCAAACCAG
gtaccttagtttttatttattggtgggtacagatcatattctccagttttcatagccata
attgtggcaatgaaacatttcagagaaacataacaaacacaaaaaaagtacagatgtttc
cttaccttgaccttggtaaggaaaaagaaatttaccaagaagagacagtgttcaatggtg

 2.11 Intr +  86326  86446  121  1  1  105   98   133 0.995  15.58
tggtttaagataaatgcagatggacctgtgatcacttttttagatcaaagacctaaagag
tcctgtctgtatgctacatatcaatcatgcgataggattttatatctcctttggtgggta
catcctcaaaggtactaaggaaaatcattactgccctttcctttccttgatctcttgcag
AAAGGAACTTACAGATTTCTTACGGAAATTGAAGGATGCTTATGGAAAATCCTTGTCTGA
ACTGACATTTGATGAAATTGTTTGCAAGATTTCCCAGTTTATTGACCCCAAAAAGTCTCA
G
gtaaaatgcaaaaacaaccaaaaaacctgtatctctctgcccttaactctagtagttaac
tgttttaaatatctccataacctgttcagaaaatcagtaacttgtaatcatattaaatca
tctattaacagtaaataacaacttcaacttaacaaatgatatcagaagtctttttgaaat

 2.12 Intr +  87173  87274  102  1  0  106   92    79 0.997   9.55
tccatcacagcctgatgctgcccagcccccaaaaccagcctggaggccactcacttcaca
gggtcctgccacatgggaaggagccagtaatccagtgagactgaaatttttgattctgaa
cacatttagatttgggagaaaacaatgagctaaatttaacattttctgtattttccctag
GATGAGGAAGAGGAAGAAGAAGAGCCTTGTGTGATCTGTCATGAGAATCTGTCTCCAGAA
AATCTTTCAGTTTTGCCTTGCGCTCACAAATTCCATGCTCAG
gtaacactttaaattttcccattaatcagctaaatgagattcatactgccttacttatta
tcatatacatgtatcattatccattgttgtctcacaagttccactggatataactctgag
cttttgggtaccacacagaaacatttatgcttttcccatacatagccatggattgcattg

 2.13 Term +  87466  87576  111  0  0   69   40   113 0.977   2.18
aattttcccattaatcagctaaatgagattcatactgccttacttattatcatatacatg
tatcattatccattgttgtctcacaagttccactggatataactctgagcttttgggtac
cacacagaaacatttatgcttttcccatacatagccatggattgcattgtgctctctcag
ATCTCCATCCACCCTACAGAAGAAGGGGACAATGTTGAGAGTCAGATGGTACACAGTAGG
CAGTTCCTTCGAATAGAACTGGGACAAATGTCGATTGACGTGGTAGTTTAG
tggcagaactagcaacagcaccacttgaaattgacatgctataaataccacatagtgtcc
tttgtccataattaatgacagccccctttcataaagcataagatttatcagtctcttcag
gcttctatatttgcttttgaaagatactcaggcttgagttttgatgttagaaaaatgtga

Predicted peptide sequence(s):


>DZIP3_1|GENSCAN_predicted_peptide_1|743_aa
XHPAVEDQRKEETENKLEKSSGQLNKQENDIPTDLVPVNLLLEVKKLLNAINTLPKGVVP
HIKKFLQEDFSFQTMQREVAANSQNGEEIVPALTLRFLITQLEAALRNIQAGNYTDVSRN
IVLELEPQDSTVTEPIFKWQGKIVFTLLSPLLKQREGVSPRRAHQINIGYYLTLLFLYGV
ALTERGKKEDYTEAENKFLVMKMMIQENEICENFMSLVYFGRGLLRCAQKRYNGGLLEFH
KSLQEIGDKNDHWFDIDPTEDEDLPTTFKDLLNNFIKTTESNIMKQTICSYLDCERSCEA
DILKNTSYKFEVVRKDEYITIENLGASYRKLISLKITDTDIRPKISLKFNTKDEMPIFKL
DYNYFYHLLHIIIISGTDIVRQIFDEAMPPPLLKKELLIHKNVLESYYNHLWTNHPLGGS
WHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPKKGWNMEPPSSDISKSADILRLCKY
RDILLSEILMNGLTESQFNSIWKKVSDILLRLGMMQEDIDKVKENPIENISLDYHQLSVY
LGIPVPEIIQRMLSCYQQGIEIEELQNEEEELSPPLMEYNINVKSHPEIQFAEINKDGTS
IPSESSTESLKDLQEVKSKQRKKKKTKNKKNKDSKEDQVPYVVEKEEQLRKEQANPHSVS
RLIKDDASDVQEDSAMEDKFYSLDELHILDMIEQEHSSSPATEQTWTENDFDELREGFRR
SNYSELKEEVRTHGKEIKNLEKN

>DZIP3_1|GENSCAN_predicted_peptide_2|876_aa
MGDFNTPLSTLDRSMRQKVNKDIQELNSALHQADLIDIYRTLHPKSTEYTFFSAPHHTYS
KIDHIVRSKALLSKCKRTEIITNCLSDHSAIKVELKIKKLTQNRSTTWKLNNLLLNDYWV
HNEMKAEIKMFFETNENKDTTYQNLWDTFKAVCRGKFVALNAHKRKQERSKIDTLTSQLK
ELEKQEQTHSKASRRQEITKIRAELKGIETQKTLQKINESRSWFFEKINKIDRPLARLIK
KKREKNQIDTIKNDKGDITTNPTEIQTTIREYYKHLYANKLENLEEMDKFLDIYTLPRLN
QEEVESLNRPITGSEIEAIINSLPTKKKSRTRWIHSRILPEVQGGAVLEVLARAIRQEKE
IKGIQLGKEEVKLSLFADDMIVCLENSIISAQNLLKLISNFSKVSGYKINVQKSQAFLYT
NNRQTESQIMSELPFTIASKRIKYLGIQLTRDVKDLFKENYKPLLNKIKEDTKKWKNIPC
SWVGRINIVKMAILPKGSAGKVTTDYGETEKERLARQRQLYKLHYQCEDFKRQLRTVTFR
WQENQMQIKKKDKIIASLNQQVAFGINKVSKLQRQIHAKDNEIKNLKEQLSMKRSQWEME
KHNLESTMKTYVSKLNAETSRALTAECRRDFGLLHLEQTEKECLNQLARVTHMAASNLES
LQLKAAVDSWNAIVADVRNKIAFLRTQYNEQINKVKQGFALSTLPPVQLPPPPPSPEILM
TGIAWALPAPVGDAVPPSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAY
GKSLSELTFDEIVCKISQFIDPKKSQDEEEEEEEPCVICHENLSPENLSVLPCAHKFHAQ
ISIHPTEEGDNVESQMVHSRQFLRIELGQMSIDVVV