GENSCAN 1.0	Date run: 16-Jan-104	Time: 08:07:44

Sequence DAG1_1 : 67853 bp : 47.65% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init -   1946   1312  635  2  2   78   81   344 0.517  25.52
 1.00 Prom -  20977  20938   40                              -4.26

 2.01 Init +  41578  41862  285  0  0   54  100   321 0.351  24.98
ggatagtatgtgactgaaccactggaattgctcaagtctaaacctgcttttctttttttt
tcaggctctgtgtgctccgggatggagcaggtgtgcagagggtgagaacccagctctggg
accaagtcacttgcttccttacttagcaagactatcgacttgagcaaacttggacctggg
ATGAGGATGTCTGTGGGCCTCTCGCTGCTGCTGCCCCTCTCGGGGAGGACCTTTCTCCTC
CTGCTCTCTGTGGTTATGGCTCAGTCCCACTGGCCCAGTGAACCCTCAGAGGCTGTCAGG
GACTGGGAAAACCAGCTTGAGGCATCCATGCACTCAGTGCTCTCAGACCTCCACGAGGCT
GTTCCCACAGTGGTTGGCATTCCTGATGGCACGGCTGTCGTCGGGCGCTCATTTCGAGTG
ACCATTCCAACAGATTTGATTGCCTCCAGTGGAGATATCATCAAG
gtgagactggatataaagcataaatgaggaagagttctcattttccattttagttttggt
ggcttttccttttcaagtctaagcttcaccaattctgagctcagttcttccagtaccccc
ttagaagagggacagccactgatgttcataagagaatccctatatactcagaatagcatc

 2.02 Term +  61840  64242 2403  0  0  127   40  2843 0.913 268.78
tagtcttgtgacaggtaaataaactcagttgtgtctctctaggggggaggaatcagcttc
cccagcaggcattctgaattataccttaaacctgtcacacaattcaggttaactgttgtg
atcatattcaggttatgcagtgacaatagtatttttaatttatgcttgtgtctcttctag
GTATCAGCGGCAGGGAAGGAGGCTTTGCCATCTTGGCTGCACTGGGACTCACAGAGCCAC
ACCCTGGAGGGCCTCCCCCTTGACACTGATAAGGGTGTGCATTACATTTCAGTGAGCGCT
ACACGGCTGGGGGCCAACGGGAGCCACATCCCCCAGACCTCCAGTGTGTTCTCCATCGAG
GTCTACCCTGAAGACCACAGTGAGCTGCAGTCGGTGAGGACAGCCTCCCCAGACCCTGGT
GAGGTGGTATCATCTGCCTGTGCTGCGGATGAACCTGTGACTGTTTTGACGGTGATTTTG
GATGCCGACCTCACCAAGATGACCCCAAAGCAAAGGATTGACCTCCTGCACAGGATGCGG
AGCTTCTCAGAAGTAGAGCTTCACAACATGAAATTAGTGCCGGTGGTGAATAACAGACTA
TTTGACATGTCGGCCTTCATGGCTGGCCCGGGAAATGCAAAAAAGGTGGTGGAGAATGGG
GCCCTTCTCTCCTGGAAGCTGGGCTGCTCCCTGAACCAGAACAGTGTGCCTGACATTCAT
GGTGTAGAGGCCCCTGCCAGGGAGGGCGCAATGTCTGCTCAGCTTGGCTACCCTGTGGTG
GGTTGGCACATCGCCAATAAGAAGCCCCCTCTTCCCAAACGCGTCCGGAGGCAGATCCAT
GCTACACCCACACCTGTCACTGCCATTGGGCCCCCAACCACGGCTATCCAGGAGCCCCCA
TCCAGGATCGTGCCAACCCCCACATCTCCAGCCATTGCTCCTCCAACAGAGACCATGGCT
CCTCCAGTCAGGGATCCTGTTCCTGGGAAACCCACGGTCACCATCCGGACTCGAGGCGCC
ATTATTCAAACCCCAACCCTAGGCCCCATCCAGCCTACTCGGGTGTCAGAAGCTGGCACC
ACAGTTCCTGGCCAGATTCGCCCAACGATGACCATTCCTGGCTATGTGGAGCCTACTGCA
GTTGCTACCCCTCCCACAACCACCACCAAGAAGCCACGAGTATCCACACCAAAACCAGCA
ACGCCTTCAACTGACTCCACCACCACCACGACTCGCAGGCCAACCAAGAAACCACGGACA
CCCCGGCCAGTGCCCCGGGTCACCACCAAAGTTTCCATCACCAGATTGGAAACTGCCTCA
CCGCCTACTCGTATTCGCACCACCACCAGTGGAGTGCCCCGTGGCGGAGAACCCAACCAG
CGCCCAGAGCTCAAGAACCATATTGACAGGGTAGATGCCTGGGTTGGCACCTACTTTGAG
GTGAAGATCCCGTCAGACACTTTCTATGACCATGAGGACACCACCACTGACAAGCTGAAG
CTGACCCTGAAACTGCGGGAGCAGCAGCTGGTGGGCGAGAAGTCCTGGGTACAGTTCAAC
AGCAACAGCCAGCTCATGTATGGCCTTCCCGACAGCAGCCACGTGGGCAAACACGAGTAT
TTCATGCATGCCACAGACAAGGGGGGCCTGTCGGCTGTGGATGCCTTCGAGATCCACGTC
CACAGGCGCCCCCAAGGGGATAGGGCTCCTGCAAGGTTCAAGGCCAAGTTTGTGGGTGAC
CCGGCACTGGTGTTGAATGACATCCACAAGAAGATTGCCTTGGTAAAGAAACTGGCCTTC
GCCTTTGGAGACCGAAACTGTAGCACCATCACCCTGCAGAATATCACCCGGGGCTCCATC
GTGGTGGAATGGACCAACAACACACTGCCCTTGGAGCCCTGCCCCAAGGAGCAGATCGCT
GGGCTGAGCCGCCGGATCGCTGAGGATGATGGAAAACCTCGGCCTGCCTTCTCCAACGCC
CTAGAGCCTGACTTTAAGGCCACAAGCATCACTGTGACGGGCTCTGGCAGTTGTCGGCAC
CTACAGTTTATCCCTGTGGTACCACCCAGGAGAGTGCCCTCAGAGGCGCCGCCCACAGAA
GTGCCTGACAGGGACCCTGAGAAGAGCAGTGAGGATGATGTCTACCTGCACACAGTCATT
CCGGCCGTGGTGGTCGCAGCCATCCTGCTCATTGCTGGCATCATTGCCATGATCTGCTAC
CGCAAGAAGCGGAAGGGCAAGCTTACCCTTGAGGACCAGGCCACCTTCATCAAGAAGGGG
GTGCCTATCATCTTTGCAGACGAACTGGACGACTCCAAGCCCCCACCCTCCTCCAGCATG
CCACTCATTCTGCAGGAGGAGAAGGCTCCCCTACCCCCTCCTGAGTACCCCAACCAGAGT
GTGCCCGAGACCACTCCTCTGAACCAGGACACCATGGGAGAGTACACGCCCCTGCGGGAT
GAGGATCCCAATGCGCCTCCCTACCAGCCCCCACCGCCCTTCACAGCACCCATGGAGGGC
AAGGGCTCCCGTCCCAAGAACATGACCCCATACCGGTCACCTCCTCCCTATGTCCCACCT
TAA
cccgcaagcgcctgggtggaggcagggtagggcaggggcctggagacgacatggtgttgt
ctgtggagaccggtggcctgcagaccattgcccaccgggagccgacacctgacctagcac
acactgacacaggggcctggacaagcccgccctctctggtcctcccaaaccccaaagcag

Predicted peptide sequence(s):


>DAG1_1|GENSCAN_predicted_peptide_1|212_aa
MTEPTKALSSSDRAVAAAVPFPASSGARLPTVGIRPNWATTPIGSQGGGPQAAHDRGQGA
GSTFPGARAELRPGPSPRRAARALQPNAPSLCLRDPEQRGGSARAAPPPHPQGRPRPCPR
PGPNSEQQQVFRGRLSRQQGWGPKQPGTADRAGGALTQRRREDRGRCSLLLAPGRRHRRS
PGIRREAAAAATAKPKRRERRAAAFARARTGX

>DAG1_1|GENSCAN_predicted_peptide_2|895_aa
MRMSVGLSLLLPLSGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVSITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSCRHLQFIP
VVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP