GENSCAN 1.0	Date run: 16-Jan-104	Time: 07:21:32

Sequence COLQ_1 : 74017 bp : 46.55% C+G : Isochore 2 (43 - 51 C+G%)

Parameter matrix: HumanIso.smat

Predicted genes/exons:

Gn.Ex Type S .Begin ...End .Len Fr Ph I/Ac Do/T CodRg P.... Tscr..
----- ---- - ------ ------ ---- -- -- ---- ---- ----- ----- ------

 1.01 Init +   1327   1432  106  0  1   95   99    36 0.578   5.37
gagggagagggaaagagaaagagggaaagacacacacacacacagacacacacacacacg
cacacacacacacacaaacacacgcgcacgcaaacagcagtgaggaagagaaaagcagag
ataagcaaggctccgcagcagcctcctttctaacttgaccctcgccagaccctggccagc
ATGGTTGTCCTGAATCCAATGACTTTGGGAATTTATCTTCAGCTTTTCTTCCTCTCTATC
GTGTCTCAGCCGACTTTCATCAACAGCGTTCTTCCAATCTCAGCAG
gtaaatgatggccacaactttcctctcttccatctgtcaggggacagggggaggaaggaa
gattgttttgcaatgtgtcctgatgtttttgccattcaactgttggtggagggaggttgg
aaggaagacggccaccccagcagcttcctgtcacccgagcttgtctcggaagccccttct

 1.02 Term +  10531  10691  161  2  2   82   48    45 0.053  -2.00
ctttttgcttaaaatatccagtgagttacggcaaaaaagaagagactcagcttccaccca
ctttgcatttataaaccagcccctaaagaaggaacacgttgcccagagaaggaggcttct
cgtggtgaccggcttccccagatgctttaaaaatacacctggccctcttccatctcccag
CCCAGGAGCATTTAGCTCCATTCAAGCCCGCACTTATCTCTCATGGCAACCAGCATAAAC
ACAGGCATGGGGCGCGTGTTTGGGAGCTGGTGACAGCTGAAGGAGAGGCCTCGTGGCTGC
TACAGGCTTTGCACCATCAACCAGCTGCGGGCTGCAAATGA
aaaaagagaggaaagaaaagaaggaagcatcggtgtgagtcgggcaggttcctccctccc
aggcatcccacactttcctcactcatccttctgtaccactctcctcttccttctttgaga
agtttggagaaggcatcaggagctttcctgctgctgctgggagttctgtcctgggaccat

 2.01 Init +  24365  24440   76  1  1   84   92    59 0.499   5.16
ctcaggactggctccagacccctggcatctggagcagaagcaacatcaaagcagggattg
gccaactcccacccctaatgccaaacaggccaggcactgggagcactcagaggcgtgacg
aatctcagcctgtctccggctagtgttccctggccagtccgctttgggccctgcctcaca
ATGACGGGCTCATCATTCAGCCTCGCTCATCTGCTCATCATTTCAGGACTGCTCTGTTAC
TCGGCAGGCTGCTTGG
gtgagttgtgtgtgcgtgtgtgcacgtgtgtgtgtgtgtgtggatgcacatgcattgttt
tggaaaaaagactcttggaaagcagactgtactaggaggttttagcagcctttaaatttt
ttttctttttaagtttttctttcacagggctgtttctcattgtgaaagcctttaaatttt

 2.02 Intr +  29356  29526  171  2  0    0  100    82 0.137   0.51
tctgcctggccttcctcaggagaaactcctcccacagcctctgttgagctggtgacagac
cctgagatcctgctaaagactgggtctgagtctggtccagggcaggctctgcttagctgc
ccccatgacctgtcacctggctgggcaaacagattccctgtggtggctatttgaactaag
ACCCACAAGGGGATGTTCCAGACAAAGCAGATGGGGGAGGTAAAAGAGGTGAGGCAAGAC
TGGGTCAGCCGTCATGGAGAGATGGGCGTGAAGACGCCAAAGAGGATGGAATGGATCAGA
TGCACAGAAAGAAGCATAAAAGGGGAGATGGGGGACAGGGGATCGAGGAAG
gtgagagaaataccaggacagtgtcatgtcccattgactcattggctccagctctttctg
acagttgttaactttacaataaatctcctttttccccagagcccatgtgagtgaagctct
gcttctcacaatccaagtagccctgaatggaacatgggtctttctcctgccattcctccc

 2.03 Intr +  33315  33427  113  1  2   34  117    54 0.235   3.00
gcaagggcaagggaataattgctatgtcaagtagccaacaggaggcctatccacatctaa
caggctagaaattagatgtggaagtctggggtggcaggatgggtcttccctgggcacggt
gggtgtgacagaggcccagcactgaccacatgctaacgagcggcagttttctctgaacag
CCCTTCCCAGCCTGGATCAGAAGAAGCGTGGTGGCCACAAAGCATGCTGCCTGCTGACGC
CTCCTCCACCACCACTGTTCCCACCACCATTCTTCAGAGGTGGCCGAAGTCCG
gtgagtactttgggatttatgagaggaaaaaaagtgcaggctactcagtgcacaccacgc
agccccacctgcctgccccactccacctgagctgcctccggaatcttttctgagagcctc
aaccctccactgtcacccagaagttgagccccggaatggacattttgcagttcctggggt

 2.04 Intr +  34645  34746  102  0  0   48   77    57 0.171   0.97
gagcagatgagagaacagaaactggtagcccaaggtgtcatcttcttggggcagtcattg
gggtgtcagggaactgccaggcttagagacctgatcccggagcaggtctgtgtccaggat
ggtgacccttcctctgtcccctacgcctgacctctaactctgtgttgctttgtactgaag
CTTCTCTCCCCAGACATGAAGAATCTCATGCTGGAACTGGAGACCTCGCAGTCCCCGTGC
ATGCAAGGCTCGCTAGGCTCCCCTGGGCCTCCCGGCCCCCAG
gttggtgcactctaccggacccctctcgctgtcttctgtttagagcaggaaagcccactg
cacagagcctcttagtgtctgctctttctcatgtgatacaaagctgtttttccttctctc
gcttacttcctgctccaaagccacttggatagaacactgactctttgctaggtaaattct

 2.05 Intr +  35182  35340  159  0  0   51   85    45 0.458   0.68
tcaaatgaggatgccacctctatggatatggtttttattacagttacaatcagacaaaca
cttgatgacagtgccccttatgtaaccattgacccctcctgtggacccagaggtgcctgc
gttcagcacaggaaagtggaggtgcagaggagatggtttcctgcctcactgggcccccag
GTATTGCTACCAAGCAGCCCACCCCTCCCCACCAAAGCTAAAGGGGAAACAGTCAAAATG
CTGCAGAAAGGATTTCTAGACAAACAAGAGTACCCTCCAGAGACCCCACCCCACAGAGTC
CTGGCCCCTCTGGCCTGCCTCCAAGAGGGTGCTCCATCG
gtgagggacagctgggtctgagccttccatggggaggagaaagagggtgtaaggagcagt
tagttcccaagtgccttcccatgcagggggcgtaaaaatgacatcacccacctgggtaaa
cactcctgtggcttctggacacttgaaggctcacctggattacaaagccccacaagaggg

 2.06 Intr +  37752  37914  163  2  1   80   71    47 0.974   1.75
gagaatggacagactgcctcctcaagtgggaccctgacccccaagtagcctaactgggag
acacctcccagtaggggccgactgacacctcatacagctgggtgcccctctgagatgaag
cttccagaggaaggctcaggcagcaacatttgctcttctgcaatatttgctgttctgcag
CCTCCACTGGTGATACCCAGGCAAACAGGGTCTGGAGTGGACCTCCAGCAAACTCCAACA
GACCTGCAGCAGAGGGTCCTGACTGTTAGAAGGAAAACTAACAAACAGAAAGGACATCTA
CACCAAAATCCCATCTGTACATCACCATCATCAAAGACCAAAG
gtagataaaaccacaaagatggagagaaaccagagcagaaaagctgaacattctaaaaat
cagagtgcctcttctcctccaaaggagtgcagctcctcaccagcaatggaacaaagctgg
acagagaatgactttgatgagttgagagaagaaggcttcagacgatcggtaataacaaac

 2.07 Term +  38205  38692  488  1  2   17   38   297 0.980  12.46
acaaagctggacagagaatgactttgatgagttgagagaagaaggcttcagacgatcggt
aataacaaacttctccgagctaaagaagctaaaaccttgaaaaaagattagatgaatggc
taactagaataaacagtgtagagaagaccttaaatgacctgttggagctgaaaaccacag
CACGAGAACTACACAACACATGCACAAGCTTCAGTAGCCAATTCAATCATGTGGAAGAAA
GGGTATCAGTGATTGAAGATCAAATGAATGAAATGAAGCGAGAAGAGAAGTTTAGAGAAA
AAAGAGTAAGAAGAAATGAACAAAGCCTCCAAGAAATATGGGACTATGTGAAAAGACCAA
ATCTACGTCTGATTGGTGTACCTGAAAGTGACGGGGAGAATGGAATCAAGTTGGAAAACA
CTCTTCAGGATATTATCCAGGAGTACTTCCCCAACCTAGCAAGGCAGGCCAACATTCAAA
TTGAGGAAATACAGAGAACGCCACAAAGATACTCCTCAAGAAGAGCCTGCCTTTCAAGAG
TTCCTGAAGGAAGCACTAAACATGGAAAGGAACAACTGGTACCAGCCACCACAAAATCAT
ACCAAACGGTAAAGACCATCAACACCATGAAGAAACTGCATCAACTAATGAGCAAAATAA
CAAGCTAA
catcataatgacaggatcaaattcacacataacaatattaaccttaaatgtaaatgggta
aatgctccagttaaaaaacacagactggcaaattggatagagtcaagacccatcagtgtg
ctgtattcaggagacccatctcacgtgcagagacacacataggctcaagataaagggatg

 3.01 Init +  40954  41357  404  0  2   60   39   173 0.501   5.70
ggaagtcaagttgtccctgtttgcagatgacatgattgtatatttagaaaaccccatcat
ctcagcccaaaatctccttaagctgataagcaacttcagcaaatctcaggatacaaaatc
aatgtgcaaaaatcacaagcattcctatacaccaataacagacaaacagagaggcaaatc
ATGAGTGAGCTCCCATTCACAATTGCTTCAAAGAGAATAAAATACCTAGGAATCAAACTT
ACAAGGGATGTGAAGGACCTCTTCAAGGAGAACTGCAAACCACTGCTCAATGAAATGAAA
GAGAACAGAAACAAATGGAAGAACATTCCATGCTCATGGATAGGAAGAATCAATATTGTG
AAAATGGCCATACTGCCCAAGGTAATTTATAGATTCAGTGCCATCCCCATCAAGCTACCA
ATGACTTTCTTCACAGAATTGGAAAAAACTACTTTAAACTTCATATGGAACCAAAAAAGA
GACCACATTGCCAAGACAATCTTAAGCCAAAAGAAGAAAGCTGGAGGCATCACACTACCT
GACTTCAAACTATACTACAAGGCTACAGTAACCAAGACAGCATG
gtactggcaccaaaacagagatatagaccaatggaatagaacagagccctcagaaataat
accacacatctacaaccatctggtctttgacaaacctgacaaaagcaagaaatggggaaa
ggattccctgtttaataaatggtgctgggaaaactggctagccatatgtagaaagctgaa

 3.02 Intr +  43949  43994   46  2  1  111   65    43 0.866   2.71
cacatatgggataccactggtgtattttgacgtggcctatcgacatggcagaggggccgt
gagcagcagccaagcaactgagccacatggccatgcccagtcatcagctctactaaggct
tctgcttccagaacatctcttccaaagcagcctctccttacctgtcttctccatccatag
GGGGAGCTTGGCCGACCAGGAAGGAAGGTATGGTCTGCGCTGTTCT
gtgagtgtcacatgagcgtctgtgcttcatgtgtgtgcatgcactcctagggagggggga
acagcaatgcacttcagtggtcactgatacccaggtggacagtgatggtgctgctgtctc
gatggtgacagtagtaaccttgccctttctgtcaacttctttgttcaggagcaggagcct

 3.03 Intr +  45755  45826   72  1  0   70  110     1 0.472   0.10
atgatacagtgtgacaccaagggcttgtcaggccatcagtcttcggagagtggggatgag
ggtcatagtagccatgcctagagaacccactgtctcctctgggccccagagacaaaacat
atttattagaagtaaagaaacaaacccagttgccctgacttttgttcttggtctttgaag
GGTAGACCTGGCCCCCCAGGTGTTCCTGGCATGCCTGGGCCCATCGGTTGGCCAGGCCCT
GAAGGACCCAGG
gtaagtgtggcatgctctcagggctcatgcggtgtcaaaacaagaggggggaagatggca
gctttcctggctcctggcacatagtcagggaatcccttcttcaagagggggaagaagaag
agagcttaaggactggccacagggccccagatacttcctccttcacttggcctgcaagac

 3.04 Intr +  47465  47527   63  1  0   83   86    48 0.831   3.01
tgaaatgtggagtacggagttttgggacctcaggagggagaaagtgggtgcatctggggt
cctcagatttacaagccagccctgatatccccagttccttcccaatcttgcctgtgactt
cctggttcagtttctctaaaaaatatcaccgtgggtcttttcttcttctaattcccacag
GGTGAAAAAGGTGACCTGGGTATGATGGGCTTGCCAGGGTCAAGAGGACCAATGGGCTCC
AAG
gtcagtgtggggtccaaatggacgttcccagatctctgtcaggctctggagcagctgctg
tctacaaacatagggactgggtggggctgcagtcccggactagggaatgtcgcggatatt
ggagagcctgcctttaccagccctttggagaacatcatgccctgggatgcaggggcatag

 3.05 Intr +  48001  48027   27  0  0  109   96    -1 0.662   1.11
ggcctggtataaccacaaccctctgggacatctttgtgtttggtgctgcaaccccactaa
aactcacagtgcaatgtggagacataccttaccaccacattcagggattccttctattct
tccaccaaactcagaagtcctacagggctgattgtaaatgtaccttctgctttcttttag
GGCTACCCTGGATCCAGAGGGGAAAAG
gttagtgcttttcttggatggtgtcctagagcctggtctgggctactggctctggaatca
gagacatgcagagaatgggtccaggtctctctttagtctgcaactgaagccaccatccct
agctattccccaccctttgtcagtggactgagagagaagtgagggacctcctgaagcagg

 3.06 Intr +  48680  48724   45  1  0  106   90    37 0.922   4.31
ggttcaacaagaagtagatcacaaagcattccttccctggagaagtcacctgacatatct
gagcctatttcttcacttgtaaaatgagggttttggtttagggagcttttcagtttgaaa
tgcttgaatttccctcccaggatattaactcattgactttctcctatggtttcttcctag
GGATCCAGAGGTGAAAAGGGTGACCTGGGTCCCAAAGGAGAAAAG
gtaatggagaaaacctttccatagaaatgataaatgtcagtgcaagtagcagcccccacc
cacccccatccgtggactgatgatggactgatggacaggcctccatcttgaaaatgacca
acaaagcctgtccacagccatttcaggtgttatttcagaggtgatcacaattatttgttg

 3.07 Intr +  48917  48952   36  1  0   91  106     6 0.653   1.16
acctttccatagaaatgataaatgtcagtgcaagtagcagcccccacccacccccatccg
tggactgatgatggactgatggacaggcctccatcttgaaaatgaccaacaaagcctgtc
cacagccatttcaggtgttatttcagaggtgatcacaattatttgttgctcttttcacag
GGTTTCCCAGGATTTCCTGGAATGTTGGGGCAGAAA
gtaagtaaccttgaggtagtgaaaataggcctcaataaaaatatcaggtcctccaagcac
aacaaaaagaactctgcctccttgtctatcaggcagggatggtgggtttaaccatggaaa
cttctattttgggacgggaagcaagttgcttttcaccctggggagagggtggcaggatgg

 3.08 Intr +  52336  52416   81  0  0  133  110    63 0.993  12.83
agacatgtctgcctttctcatgacttcctcactctgctaaccttgcagggcagcccagtt
ggcatagattcggaatgatcaagtagactgccctcgtagccaatgactggctagacctgt
gtagatgtgcccactccacatgccctaagtcctctcttgcttctctttccttctttccag
GGTGAAATGGGTCCAAAAGGTGAACCTGGGATAGCAGGACACCGAGGACCCACAGGAAGA
CCAGGAAAACGAGGCAAGCAG
gtaaggatcccagggcttaccacccgcctgaggtcagaacttcctgacctggcagtgtgt
ggagtggcaggcaggtggcgttaatcagagatattctgtagaccttgactccagcatcct
ctgggctagcagacgggagcagcaccacttccagaagctgctggcatctctaggctagcc

 3.09 Intr +  56515  56611   97  0  1   91  110    34 0.852   5.48
tatctcaaatgtcacttgccctaagcttattaagagctcgatggtcaagacctctggagc
tgcatcccccactgggctcttgctccttaagtgcaaggtgatctctgatttggtgataaa
tggggcgggaagcttgctatgtcatgctttcataacaggctctgcctttctctctgtcag
GGACAGAAAGGGGATAGTGGAGTTATGGGCCCACCAGGCAAGCCTGGGCCTTCTGGTCAA
CCTGGCCGTCCGGGGCCCCCAGGCCCCCCACCTGCAG
gtaagagctacactgcttcacttgatccactgttggagtactggccagcctcccagagag
ggcacaaggagatgccagcagagatgccttgtgtttcaagttagaaactaccagagacac
tccaatatctttgtaatttctccacgatttagctcattcaacttttatgcaagagagata

 3.10 Intr +  64627  64766  140  2  2   74   79    50 0.648   2.88
tcttaccttagctcctccatgtcttggatcaaaagcatctctttgaacctctccctcagg
cataccctgaaatgctgtggactttaaccttttttctgttgcaaaggtcgctcacatctc
cctggttgtttggtcttctcttccttggctctagtaacacagcagtctgttgcttcctag
GACAACTTATAATGGGACCCAAAGGGGAAAGAGGATTTCCCGGGCCTCCAGGAAGATGTC
TTTGTGGACCCACTATGAATGTGAATAACCCTTCCTACGGGGAATCTGTGTATGGGCCCA
GTTCCCCGCGAGTTCCTGTG
gtaaggctttctgggagaagtctggggtggttatccgtgaggacctctcacctgatcctt
atggggctttgtaaaatcctttcagtaaaactaactttttttcacgactctgagtacacc
ctcattataggaaattggaaaatatgagaaaatcaagaggaaaaccaaattgtccatttg

 3.11 Intr +  66373  66492  120  0  0   49   80   152 0.878  11.19
agaagatgagggaatcaagacactcctctcacttcagaaggaatgctagagtgtagtgtg
caaacccctcttcccactgttgagcagcccaaggatagagattctgtttcctcctccagc
ttttttcctgccccctgcagaagtgttttctggaatcctcaccagtgtgttctctggcag
ATTTTTGTGGTCAACAACCAGGAGGAGCTTGAGAGGCTGAACACCCAAAACGCCATTGCC
TTCCGCAGAGACCAGAGATCTCTGTACTTCAAGGACAGCCTTGGCTGGCTCCCCATCCAG

gtacccccaggccattacctcaggacatactccctgcccaggagagagatgcatccatta
aaggaagggaaggccaccccactgggcctggggagggctttctacagtctgtctgcatgg
gagggctgagcatcctccctcaaactctctctgagcagccctccattcccccaccctgac

 3.12 Intr +  66933  67053  121  2  1   67   75    96 0.954   6.27
acccaacatttaaccagctacagagctctgggcaacaggaaaggagtacctttcccaccc
ctgggaggaagtcaaggcatgccccccagcagtgcctttggaccaaaaccaatgacctcc
ctgcctgcggctgcctgggtatgccatgctccagttaatgctgtgtgcttctttggccag
CTGACCCCTTTCTACCCTGTGGATTACACTGCAGACCAGCACGGCACCTGTGGGGATGGG
CTCCTGCAGCCTGGGGAGGAGTGTGACGACGGTAACAGCGATGTGGGTGACGACTGCATC
C
gtgagtgaggcccagaccaggaggacctgaggcctgaacagcaggggggtgggactcagg
gccagccctggacaccagctgtggtgctttgggacctttctagagccagagaagggtata
cccaggccaccttgtgccacccaccccagtccctgctgccccagtttcagcccaaatatt

 3.13 Intr +  69021  69123  103  1  1  106   45   143 0.996  11.03
atcgctgtgggaccagagcctgtgggcagtccctggaggagtgtgaagcttaatggaggt
cagttctttaaggggtgcagcacttaggttggatcccttgggccgcatggtccttacaag
ctgaggcaagcctatcgcctctgctccttctcaagactgcacctccttatgtcccctcag
GCTGTCACCGTGCCTACTGTGGAGATGGTCACCGGCATGAGGGTGTGGAGGACTGTGACG
GCTCTGACTTTGGCTACCTGACATGCGAGACCTATCTCCCTGG
gtagggatgactcccctccctccctctcccccttctttctccctccctcctctttgcttt
ccttctttccttcacaaatattttgagtgcctctccactttgtggtgccttctagacact
gaggtatggtgatgaatgacacaacacgtgctccctgcctaccacgtgccctcttggtca

 3.14 Term +  71239  71308   70  1  1   81   55   170 0.947  10.41
agacctcaaggcaaaaatcccagagacatgattcaactcccccaggcctctcactccaaa
tgagaatgggaaaaagttcttgtagagccattggcccttggccgctgtttgataaggttt
gaccggaagtcaccagcatataagaggtggccttttagaacgtgtctttgcctccctcag
GTCATATGGAGACCTGCAATGCACCCAGTACTGCTACATCGACTCCACGCCCTGCCGCTA
CTTCACCTGA
gggccgtgaggagaaggtgggctgcgccccacagaactggcagcagcttctccactgtca
tcaaactggccatgtcctggccccgtctccaccaacctttgtgtgacaaaaacaaggaca
aattcctgctactaagacatgctgttaactcagtctgactggaagaatttaggaccactg

Predicted peptide sequence(s):


>COLQ_1|GENSCAN_predicted_peptide_1|88_aa
MVVLNPMTLGIYLQLFFLSIVSQPTFINSVLPISAAQEHLAPFKPALISHGNQHKHRHGA
RVWELVTAEGEASWLLQALHHQPAAGCK

>COLQ_1|GENSCAN_predicted_peptide_2|423_aa
MTGSSFSLAHLLIISGLLCYSAGCLDPQGDVPDKADGGGKRGEARLGQPSWRDGREDAKE
DGMDQMHRKKHKRGDGGQGIEEALPSLDQKKRGGHKACCLLTPPPPPLFPPPFFRGGRSP
LLSPDMKNLMLELETSQSPCMQGSLGSPGPPGPQVLLPSSPPLPTKAKGETVKMLQKGFL
DKQEYPPETPPHRVLAPLACLQEGAPSPPLVIPRQTGSGVDLQQTPTDLQQRVLTVRRKT
NKQKGHLHQNPICTSPSSKTKARELHNTCTSFSSQFNHVEERVSVIEDQMNEMKREEKFR
EKRVRRNEQSLQEIWDYVKRPNLRLIGVPESDGENGIKLENTLQDIIQEYFPNLARQANI
QIEEIQRTPQRYSSRRACLSRVPEGSTKHGKEQLVPATTKSYQTVKTINTMKKLHQLMSK
ITS

>COLQ_1|GENSCAN_predicted_peptide_3|474_aa
MSELPFTIASKRIKYLGIKLTRDVKDLFKENCKPLLNEMKENRNKWKNIPCSWIGRINIV
KMAILPKVIYRFSAIPIKLPMTFFTELEKTTLNFIWNQKRDHIAKTILSQKKKAGGITLP
DFKLYYKATVTKTAWGSLADQEGRYGLRCSGRPGPPGVPGMPGPIGWPGPEGPRGEKGDL
GMMGLPGSRGPMGSKGYPGSRGEKGSRGEKGDLGPKGEKGFPGFPGMLGQKGEMGPKGEP
GIAGHRGPTGRPGKRGKQGQKGDSGVMGPPGKPGPSGQPGRPGPPGPPPAGQLIMGPKGE
RGFPGPPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRR
DQRSLYFKDSLGWLPIQLTPFYPVDYTADQHGTCGDGLLQPGEECDDGNSDVGDDCIRCH
RAYCGDGHRHEGVEDCDGSDFGYLTCETYLPGSYGDLQCTQYCYIDSTPCRYFT